DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and arih1

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001116952.1 Gene:arih1 XenbaseID:XB-GENE-972160 Length:529 Species:Xenopus tropicalis

Alignment Length:538 Identity:173/539 (32%)
Similarity:281/539 (52%) Gaps:63/539 (12%)


  Fly     1 MDSDIEMDMESDNDGEYDDDYDYYNTGEDCDVERLD--------------------------PKR 39
            ||||...:.|.|::.|..:|.......:|.::..::                          |..
 Frog     1 MDSDEGYNYEFDDEEECSEDSGADEHEDDLELGEVELVEAGLSGSERAGICGEGGGSALGPGPGG 65

  Fly    40 ADPEYFEYECLTVEDIEKLLNERVEKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLV 104
            .:.|.:.||.||.|.|.:.:.|.:.::|.::|...::.::||....|:...::|:| .|.|...:
 Frog    66 EEEEDYRYEVLTAEQILQHMVECIREVNEVIQNPATITRILLSHFNWDKEKLMERY-FDGNLEKL 129

  Fly   105 TAR---IKPPSVAVTDTASTSAAAASAQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFY 166
            .:.   |.|...:.|...:|.::|                       :...|.:|..:.....|.
 Frog   130 FSECHVINPSKKSRTRQMNTRSSA-----------------------QDMPCQICYLNYPNSYFT 171

  Fly   167 SLACGHSFCKDCWTIYFETQIF-QGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFK 230
            .|.|||.||..||:.|..|:|. :|:...|.|.|..|::.|.::.|:.|:|...::.|||.....
 Frog   172 GLECGHKFCMQCWSEYLTTKIIEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITN 236

  Fly   231 DYVKSHPELRFCPGPNCQIIVQSSEISAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCA 295
            .:|:.:..|::||.|:|..:|:.....||...|| |...|||.||.::|.|..|:.:|||:.||.
 Frog   237 SFVECNRLLKWCPAPDCHHVVKVQYPDAKPVRCK-CGRQFCFNCGENWHDPVKCKWLKKWIKKCD 300

  Fly   296 DDSETANYISAHTKDCPKCHICIEKNGGCNHMQC--FNCKHDFCWMCLGDWKTHGSEYYECSRYK 358
            |||||:|:|:|:||:|||||:.|||:||||||.|  .|||.:|||:|||.|:.|||.:|.|:||.
 Frog   301 DDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYN 365

  Fly   359 DNPNIANESVHVQAREALKKYLHYYERWENHSKSLKLEQQTIDRLRQRINSKVMNGSGTWIDWQY 423
            ::...|......::|.||::||.|..|:.||.:||:.|.:...:::|:: .::...:.:||:.|:
 Frog   366 EDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKM-EEMQQHNMSWIEVQF 429

  Fly   424 LFNAAALLAKCRYTLQYTYPYAYYMEAGSRKNLFEYQQAQLEAEIENLSWKIERAETTD-LGDLE 487
            |..|..:|.:||.||.|||.:|:|::..::..:||..||.||...|.||..:||..:.| |.|::
 Frog   430 LKKAVDVLCQCRSTLMYTYVFAFYLKKNNQSIIFENNQADLENATEVLSGYLERDISQDSLQDIK 494

  Fly   488 NQMD----IAEKRRTTLL 501
            .::.    ..|.||..||
 Frog   495 QKVQDKYRYCESRRRVLL 512

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 22/62 (35%)
arih1NP_001116952.1 UBA-like. {ECO:0000250|UniProtKB:Q9Y4X5} 77..125 12/49 (24%)
TRIAD supradomain. {ECO:0000255|PROSITE-ProRule:PRU01221} 154..365 93/212 (44%)
IBR 229..289 CDD:214763 22/61 (36%)
IBR <311..351 CDD:279784 27/40 (68%)
Ariadne domain. {ECO:0000250|UniProtKB:Q9Y4X5} 380..529 47/135 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429758at33208
OrthoFinder 1 1.000 FOG0000641
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.