DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and DEG1

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_116655.1 Gene:DEG1 SGDID:S000001895 Length:442 Species:Saccharomyces cerevisiae

Alignment Length:406 Identity:143/407 (35%)
Similarity:208/407 (51%) Gaps:56/407 (14%)


  Fly    27 TQTELIDKVIQLEAYNFQLRNLLQKKLSEKDKHDKEYSGLIGNEAEGKVSQVAKTSSKVQKI-RK 90
            ::.:||.::.:||..|        |..|||.:|       |.:..:.|:||...|.||.:|. :|
Yeast    34 SKEQLIRRITELENAN--------KPHSEKFQH-------IEDNKKRKISQEEVTRSKAKKAPKK 83

  Fly    91 FDWSSAHKRHVLLKITYFGWDYQGFACQEDSN--DTIESNLFRALARTCLIESRATSNY--HRCG 151
            ||:|..:.|.:.|:..|.||:|.|.|.|::..  .|:|..:..|:.:..|:.|....:|  .|||
Yeast    84 FDFSKHNTRFIALRFAYLGWNYNGLAVQKEYTPLPTVEGTILEAMNKCKLVPSMVLQDYKFSRCG 148

  Fly   152 RTDKEVSAFCQVISIDLRSKHPPESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLRSPVYSA 216
            ||||.|||..||||:::||....|.|.|||..|.||.|..:||::||.:|:..|......|.:.|
Yeast   149 RTDKGVSAMNQVISLEVRSNLTDEEQRDPTNDSREIPYVHVLNQLLPDDIRISAVCLRPPPNFDA 213

  Fly   217 RFDCVSRTYRYYFPKGDLDIAAMRKACDLLVRHADFRNFCKMDVHNGVTNYMRNLQSARVEACDQ 281
            ||.||.|.|:|.|...:|:|..|.||....|...|||||||:|....:||:.|.:.|:::....:
Yeast   214 RFSCVHRHYKYIFNGKNLNIEKMSKAASYFVGERDFRNFCKLDGSKQITNFKRTIISSKILPLSE 278

  Fly   282 TNHTNSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPGVISDLLDVESNPCKPQYTPAIG 346
            |        .|..::..:||||||:||:||:|.||||..|.|.::..|.|:|..|.:|.|..|..
Yeast   279 T--------FYCFDLVGSAFLWHQVRCMMAILFLVGQSLEVPEIVLRLTDIEKTPQRPVYEMAND 335

  Fly   347 LPLNLFRCDFRDHTTRSVNHPSSGDADEEAMD-------TAADESNDLN-----APEHLERDL-- 397
            :||.|:.|.|.:.           |..|..:|       |.|.|:..|:     |..::.:|:  
Yeast   336 IPLLLYDCKFPEM-----------DWQEPTVDDYKAIKFTTATEALTLHYELKAAVCNIFKDVLP 389

  Fly   398 TAWIYNEENLQKLIEN 413
            ||   |..|..|.|.|
Yeast   390 TA---NTNNFSKTIIN 402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 106/279 (38%)
PseudoU_synth_ScPus3 103..356 CDD:211336 103/257 (40%)
DEG1NP_116655.1 hisT_truA 92..338 CDD:272889 101/254 (40%)
PseudoU_synth_ScPus3 96..345 CDD:211336 103/257 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C44220530
eggNOG 1 0.900 E1_COG0101
Hieranoid 1 1.000
Homologene 1 1.000 H11339
Inparanoid 1 1.050 212 1.000 Inparanoid score I794
Isobase 1 0.950 0 Normalized mean entropy S1490
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004172
OrthoInspector 1 1.000 T1136890
orthoMCL 1 0.900 OOG5_126786
Panther 1 1.100 LDO PTHR11142
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1941
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.