DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and AT1G34150

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_564438.1 Gene:AT1G34150 AraportID:AT1G34150 Length:446 Species:Arabidopsis thaliana

Alignment Length:477 Identity:163/478 (34%)
Similarity:235/478 (49%) Gaps:92/478 (19%)


  Fly    28 QTELI---DKVIQLEAYNFQLRNLLQKKLSE--KDKHDKEYSGLIGNEAEGKVSQVAKTSSKV-- 85
            :|||:   ::|.:||..|.:|.:.:.....:  :.|||:..|               .:||.|  
plant    22 ETELVFLRNRVKELEVENAKLLSQVSSCQCQQMEVKHDRSLS---------------DSSSLVRR 71

  Fly    86 QKIRKFDWSS--AH---KRHVLLKITYFGWDYQGFACQEDSNDTIESNLFRALART-CLIESRAT 144
            :::||.|.:|  :|   ||:|.|||.|||..:.||:.:.....:|||.:|:||.|| .|:..:..
plant    72 RRVRKGDKNSIPSHLISKRYVALKIMYFGKRFYGFSAEAQMEPSIESEVFKALERTRLLVGDKKD 136

  Fly   145 SNYHRCGRTDKEVSAFCQVISIDLRS--KHPP---ESQLD-PTALSSEIDYCGLLNRVLPKNIQC 203
            |.|.|||||||.||:..|||::.|||  |.||   ::|:: .|....|.||..:|||.||.:|:.
plant   137 SCYSRCGRTDKGVSSTGQVIALFLRSRLKSPPGDSKAQVNGRTGERPEYDYVRVLNRALPDDIRV 201

  Fly   204 VAWMPLRSPV-YSARFDCVSRTYRYYFPKGDLDIAAMRKACDLLVRHADFRNFCKMDVHNGVTNY 267
            :.|.|  :|: :.|||.|.:|.|:|:|.:.:|:::||..|....:...||||||||||.| |..|
plant   202 IGWSP--APIDFHARFSCYAREYKYFFWRQNLNLSAMDFAGKKFIGEHDFRNFCKMDVAN-VHCY 263

  Fly   268 MRNLQSARVEACDQTNHTNSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPGVISDLLDV 332
            .|.:....|..| |.:|  .|..:....::.:|||||||||::|||.::||..|:..||..|||.
plant   264 TRRVTFFEVSPC-QNSH--EGDQLCTFTMRGSAFLWHQIRCMVAVLFMIGQGVESVDVIDTLLDT 325

  Fly   333 ESNPCKPQYTPAIGLPLNLFRCDFRDHTTRSVNHPSSGDADEEAMDTAADESNDLNAPEHLERDL 397
            :..|.||||..|..:||.|..|:|     .:|:...|..|.|.......:||        |...|
plant   326 KKTPRKPQYLLASEIPLVLRTCEF-----ENVDFICSPGAAESLRSHFKNES--------LTYQL 377

  Fly   398 TAWIYNEENLQKLIENTQCEWTQFSVKSTMIRNVLQQLENLFEE----NFKPKEKVLAQVILLQD 458
            .:.||.|                      .:||.|....|:..|    |...|:|..|       
plant   378 ESVIYQE----------------------ALRNCLPLSNNVSTEESSCNGVEKKKKRA------- 413

  Fly   459 SVNPRQYQPLLERKRCESLENR 480
                 ::.|||.|....|.|.|
plant   414 -----EHVPLLSRPTEPSYEER 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 118/283 (42%)
PseudoU_synth_ScPus3 103..356 CDD:211336 112/261 (43%)
AT1G34150NP_564438.1 TruA 89..371 CDD:223179 120/293 (41%)
PseudoU_synth_ScPus3 94..349 CDD:211336 112/261 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I1329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1093493at2759
OrthoInspector 1 1.000 T193759
orthoMCL 1 0.900 OOG5_126786
Panther 1 1.100 LDO PTHR11142
Phylome 1 0.910 0.667 Consistency score
76.970

Return to query results.
Submit another query.