DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and PUS3

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_112597.4 Gene:PUS3 HGNCID:25461 Length:481 Species:Homo sapiens

Alignment Length:477 Identity:189/478 (40%)
Similarity:265/478 (55%) Gaps:68/478 (14%)


  Fly    40 AYNFQLRNLLQKKLSEKDKHDKEYSGLIGNEAEGKV-SQVAKTSSKVQKI-RKFDWSSAHKRHVL 102
            |||...||..:|.|....:.::|...|...:|:.|. |.:.:.|:...|. |.||:|:..:|||.
Human     2 AYNDTDRNQTEKLLKRVRELEQEVQRLKKEQAKNKEDSNIRENSAGAGKTKRAFDFSAHGRRHVA 66

  Fly   103 LKITYFGWDYQGFACQEDSNDTIESNLFRALARTCLIESRATSNYHRCGRTDKEVSAFCQVISID 167
            |:|.|.||.|||||.||::|:|||..||.||.:|.|:|||.||||||||||||.||||.||||:|
Human    67 LRIAYMGWGYQGFASQENTNNTIEEKLFEALTKTRLVESRQTSNYHRCGRTDKGVSAFGQVISLD 131

  Fly   168 LRSKHPP-------ESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLRSPVYSARFDCVSRTY 225
            |||:.|.       ..:.:..|.:.||.|..:||||||.:|:.:||.|: .|.:||||.|:.|||
Human   132 LRSQFPRGRDSEDFNVKEEANAAAEEIRYTHILNRVLPPDIRILAWAPV-EPSFSARFSCLERTY 195

  Fly   226 RYYFPKGDLDIAAMRKACDLLVRHADFRNFCKMDVHNGVTNYMRNLQSARVEACDQT---NHTNS 287
            ||:||:.||||..|..|....|...||||.|||||.|||.|:.|.:.||:|:...|:   .....
Human   196 RYFFPRADLDIVTMDYAAQKYVGTHDFRNLCKMDVANGVINFQRTILSAQVQLVGQSPGEGRWQE 260

  Fly   288 GYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPGVISDLLDVESNPCKPQYTPAIGLPLNLF 352
            .:.:...|:...|||:||:||:||:|.|:||..|.|.:|.:||::|.||.||||:.|:..||.|:
Human   261 PFQLCQFEVTGQAFLYHQVRCMMAILFLIGQGMEKPEIIDELLNIEKNPQKPQYSMAVEFPLVLY 325

  Fly   353 RCDFRDHTTRSVNHPSSGDADEEAMDTAADESNDLNAPEHLERDLTAWIYNEENLQKLIENTQCE 417
            .|.|.:                                       ..|||::|..:..|.:.|..
Human   326 DCKFEN---------------------------------------VKWIYDQEAQEFNITHLQQL 351

  Fly   418 WTQFSVKSTMIRNVLQQLENL------------FEE--NFKPKEKVLAQVILLQDSVNPRQYQPL 468
            |...:||:.|:.::||.|:.:            ..|  |.||  .|:.|.....:.|..|.|:||
Human   352 WANHAVKTHMLYSMLQGLDTVPVPCGIGPKMDGMTEWGNVKP--SVIKQTSAFVEGVKMRTYKPL 414

  Fly   469 LERKRCESLENRIEHFVKKQRL 490
            ::|.:|:.||:||:|||::.|:
Human   415 MDRPKCQGLESRIQHFVRRGRI 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 135/285 (47%)
PseudoU_synth_ScPus3 103..356 CDD:211336 133/263 (51%)
PUS3NP_112597.4 PseudoU_synth_ScPus3 67..329 CDD:211336 133/263 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C44218782
eggNOG 1 0.900 E1_COG0101
Hieranoid 1 1.000
Homologene 1 1.000 H11339
Inparanoid 1 1.050 321 1.000 Inparanoid score I2481
Isobase 1 0.950 0 Normalized mean entropy S1490
OMA 1 1.010
OrthoDB 1 1.010 D1093493at2759
OrthoFinder 1 1.000 FOG0004172
OrthoInspector 1 1.000 T1075386
orthoMCL 1 0.900 OOG5_126786
Panther 1 1.100 LDO PTHR11142
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1941
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.