DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and AT3G06950

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_187351.2 Gene:AT3G06950 AraportID:AT3G06950 Length:323 Species:Arabidopsis thaliana

Alignment Length:317 Identity:81/318 (25%)
Similarity:132/318 (42%) Gaps:64/318 (20%)


  Fly    81 TSSKVQKIRKFDWSSAHKRHVLLKITYFGWDYQGFACQEDSNDTIESNLFRALARTCLIESRATS 145
            :|.||.....:.|.        |.|.|.|..:.|:..|| |..||:|.|.:||.:...: .|...
plant    31 SSVKVSDSGAYKWR--------LVIAYDGTRFAGWQYQE-SPPTIQSMLEKALIQITEL-GRKEL 85

  Fly   146 NYHRCGRTDKEVSAFCQVISIDLRSKHPPESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLR 210
            .....||||..|.|:.||...           :.|...:|...:...||.:|||:|: |..:...
plant    86 QLIGAGRTDAGVHAWGQVAHF-----------VTPFNYTSLDSFHAALNGLLPKDIR-VRELSAA 138

  Fly   211 SPVYSARFDCVSRTYRY----------------YFPKGDLDIAAMRKACDLLVRHADFRNFCKMD 259
            .|.:.|||...|:.|||                |.....|:.:.||:|.:|.|...||..|....
plant   139 VPEFHARFSASSKVYRYQIYNDTFMDPFQRHWAYHCAYKLNASKMREAANLFVGKHDFSAFANAT 203

  Fly   260 VHNGVTNYMRNLQSARVEACDQTNHTNSGYD------MYYLEIQANAFLWHQIRCIMAVLLLVGQ 318
            ..:||.:.::               |.|.:|      :..||::.:.||:.|:|.::|:|:.:|:
plant   204 REDGVPDPLK---------------TISRFDVIQMGSLLQLEVEGSGFLYRQVRNMVALLIQIGK 253

  Fly   319 KKENPGVISDLLDVESNPCKPQYT--PAIGLPLNLFRCDFR-DHTTRSVNHP--SSG 370
            :..:..::..:|:.:......:||  ||....|.|....:: ||....::.|  |||
plant   254 EALDSDIVPMILETKDRRVLAKYTSLPASPHGLCLVSVKYKEDHLKLPLDCPVTSSG 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 77/298 (26%)
PseudoU_synth_ScPus3 103..356 CDD:211336 71/277 (26%)
AT3G06950NP_187351.2 truA 42..293 CDD:234577 72/288 (25%)
PseudoU_synth_EcTruA 45..293 CDD:211337 71/277 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126786
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.