DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and PUS1

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_079491.2 Gene:PUS1 HGNCID:15508 Length:427 Species:Homo sapiens

Alignment Length:352 Identity:77/353 (22%)
Similarity:132/353 (37%) Gaps:91/353 (26%)


  Fly    98 KRHVLLKITYFGWDYQGFACQEDSND--TIESNLFRALART-CLIESRATS----NYHRCGRTDK 155
            ||.::|.:.|.|..|.|......|:.  |||.:|..||.|: |:.|:....    ::.||.||||
Human    83 KRKIVLLMAYSGKGYHGMQRNVGSSQFKTIEDDLVSALVRSGCIPENHGEDMRKMSFQRCARTDK 147

  Fly   156 EVSAFCQVISI------DLRSKHPPESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLRSPVY 214
            .|||..||:|:      |:..|                     :|..||.:|:.:....:... :
Human   148 GVSAAGQVVSLKVWLIDDILEK---------------------INSHLPSHIRILGLKRVTGG-F 190

  Fly   215 SARFDCVSRTYRYYFP-----KGDLDI---------AAMRKACDLLVRHADFRNFCKMDVHNG-- 263
            :::..|.:|||.|..|     ..|.|:         ..:::...||..:....||.......|  
Human   191 NSKNRCDARTYCYLLPTFAFAHKDRDVQDETYRLSAETLQQVNRLLACYKGTHNFHNFTSQKGPQ 255

  Fly   264 ---VTNYMRNLQSARVEACDQTNHTNSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPGV 325
               ...|:..:.      |::. ....|.:...:.::..:|:.||||.::.:::.:.:......|
Human   256 DPSACRYILEMY------CEEP-FVREGLEFAVIRVKGQSFMMHQIRKMVGLVVAIVKGYAPESV 313

  Fly   326 I-----SDLLDVESNPCKPQYTPAIGLPLNLFRCDFRDHTTRSVNHPSSGDADEEAMDTAADESN 385
            :     ::.:||...|         ||.|.|.|..|..:..|..|     |...|.:|.|.:|..
Human   314 LERSWGTEKVDVPKAP---------GLGLVLERVHFEKYNQRFGN-----DGLHEPLDWAQEEGK 364

  Fly   386 -----------DLNAPEHLERDLTAWI 401
                       .:...|..||.:..|:
Human   365 VAAFKEEHIYPTIIGTERDERSMAQWL 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 68/312 (22%)
PseudoU_synth_ScPus3 103..356 CDD:211336 63/290 (22%)
PUS1NP_079491.2 TruA 84..363 CDD:223179 72/322 (22%)
PseudoU_synth_PUS1_PUS2 88..340 CDD:211335 63/290 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.