DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and Pus3

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_075781.3 Gene:Pus3 MGIID:1914299 Length:481 Species:Mus musculus

Alignment Length:495 Identity:189/496 (38%)
Similarity:269/496 (54%) Gaps:88/496 (18%)


  Fly    20 REALEKLTQTELIDKVIQLEAYNFQLRNLLQKKLSEKDKHDKEYSGLIGNEAEGKVSQVAKTSSK 84
            |..:||     |:::|.:||....:|:...::..:.||...:|.|  :|:   ||..        
Mouse     7 RNQIEK-----LLNRVKELEQEVERLKKKKEQANNIKDSSIRENS--LGS---GKAK-------- 53

  Fly    85 VQKIRKFDWSSAHKRHVLLKITYFGWDYQGFACQEDSNDTIESNLFRALARTCLIESRATSNYHR 149
                |.||:|:..:|||.|||.|.||.|||||.||::::|||..||.||.:|.|:|||.||||||
Mouse    54 ----RAFDFSAHGRRHVALKIAYLGWGYQGFASQENTSNTIEEKLFEALTKTRLVESRQTSNYHR 114

  Fly   150 CGRTDKEVSAFCQVISIDLRSKHP-----PESQLDPTA--LSSEIDYCGLLNRVLPKNIQCVAWM 207
            ||||||.||||.||||:||||:.|     .:|.|...|  |:.||.|..:||||||.:|:.:||.
Mouse   115 CGRTDKGVSAFGQVISLDLRSQFPTSRDSEDSNLKHEADDLAKEIRYTHILNRVLPADIRVLAWA 179

  Fly   208 PLRSPVYSARFDCVSRTYRYYFPKGDLDIAAMRKACDLLVRHADFRNFCKMDVHNGVTNYMRNLQ 272
            |: .|.:||||.|:.|||||:||:.|||||.|..|....|...||||.|||||.|||.|:.|.:.
Mouse   180 PV-EPSFSARFSCLERTYRYFFPRADLDIATMNYAAQKYVGTHDFRNLCKMDVANGVINFQRTIL 243

  Fly   273 SARVEACDQT---NHTNSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPGVISDLLDVES 334
            .|:|:...|:   ......:.:...|:...|||:||:||:||:|.|:||..|.|.:|.:||:::.
Mouse   244 CAQVQLVAQSPGEERRQEPFQLCQFEVIGQAFLYHQVRCMMAILFLIGQGMEKPEIIDELLNIQK 308

  Fly   335 NPCKPQYTPAIGLPLNLFRCDFRDHTTRSVNHPSSGDADEEAMDTAADESNDLNAPEHLERDLTA 399
            ||.||||:.|:..||.|:.|.|.:                                       |.
Mouse   309 NPQKPQYSMAVEFPLVLYDCKFEN---------------------------------------TK 334

  Fly   400 WIYNEENLQKLIENTQCEWTQFSVKSTMIRNVLQQLENLFE--------------ENFKPKEKVL 450
            |||:.|..:..:.:.|..|...:||:.|:.::||.|:::..              .|.:|  .|:
Mouse   335 WIYDHEVQEFNVTHLQQLWANHAVKTHMLYSMLQGLDSVMVTCAAGTKMDEATEWRNIQP--PVI 397

  Fly   451 AQVILLQDSVNPRQYQPLLERKRCESLENRIEHFVKKQRL 490
            .......:.|..|.|:||::|.:|:.||:||.|||.:.|:
Mouse   398 KHTSAFVEGVKMRTYKPLMDRPKCQGLESRIRHFVSRGRI 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 137/285 (48%)
PseudoU_synth_ScPus3 103..356 CDD:211336 135/263 (51%)
Pus3NP_075781.3 TruA 66..336 CDD:223179 139/310 (45%)
PseudoU_synth_ScPus3 68..330 CDD:211336 135/263 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C44219285
eggNOG 1 0.900 E1_COG0101
Hieranoid 1 1.000
Homologene 1 1.000 H11339
Inparanoid 1 1.050 310 1.000 Inparanoid score I2564
Isobase 1 0.950 0 Normalized mean entropy S1490
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004172
OrthoInspector 1 1.000 T1085494
orthoMCL 1 0.900 OOG5_126786
Panther 1 1.100 LDO PTHR11142
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1941
TreeFam 1 0.960
1312.730

Return to query results.
Submit another query.