DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and Pus1

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001020732.1 Gene:Pus1 MGIID:1929237 Length:441 Species:Mus musculus

Alignment Length:419 Identity:88/420 (21%)
Similarity:150/420 (36%) Gaps:111/420 (26%)


  Fly    47 NLLQKKLSEKDKHDKEYSGLIGNEAEGKVSQVAKTSSKVQKIRKFDWSSAHKRHVLLKITYFGWD 111
            |.:...|:......|...|.:..|.|....:| |.....:..||..     ||.::|.:.|.|..
Mouse    34 NKVPPALASHQPDRKGRGGWVWEETEHPAKRV-KGGEDEEPPRKLP-----KRKIVLLMAYSGKG 92

  Fly   112 YQGFACQEDSND--TIESNLFRALART-CLIESRATS----NYHRCGRTDKEV---SAFC----- 161
            |.|......|:.  |||.:|..||.:. |:.|:..|.    ::.||.||||.:   :.||     
Mouse    93 YHGMQRNLGSSQFRTIEDDLVSALVQAGCIPENHGTDMRKMSFQRCARTDKPLRTSACFCLYTGF 157

  Fly   162 ----------QVISI------DLRSKHPPESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLR 210
                      ||:|:      |:..|                     :|..||.:|:.:....:.
Mouse   158 LFHWGVSAAGQVVSLKVWLIDDILDK---------------------INSHLPSHIRILGLKRVT 201

  Fly   211 SPVYSARFDCVSRTYRYYFP-----KGDLDI---------AAMRKACDLLVRHADFRNFCKMDVH 261
            .. ::::..|.:|||.|..|     ..|.|:         ..:::...||..:....||     |
Mouse   202 GG-FNSKNKCDARTYCYMLPTFAFAHKDRDVQDESYRLSAETLQQVNRLLACYKGTHNF-----H 260

  Fly   262 NGVTNYMRNLQSAR---VEACDQTNHTNSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENP 323
            |..:.......|||   :|...:......|.:...::::..:|:.||||.::.:::.:.:.....
Mouse   261 NFTSQKGPREPSARRYILEMYCEEPFVREGLEFAVIKVKGQSFMMHQIRKMVGLVVAIVKGYAPE 325

  Fly   324 GVI-----SDLLDVESNPCKPQYTPAIGLPLNLFRCDFRDHTTRSVNHPSSGDADEEAMDTAADE 383
            .|:     .:.:||...|         ||.|.|.|..|..:     |....||...|.:|...:|
Mouse   326 SVLERSWGEEKVDVPKAP---------GLGLVLERVHFEKY-----NQRFGGDGLHEPLDWTQEE 376

  Fly   384 SN-----------DLNAPEHLERDLTAWI 401
            ..           .:.:.|..||.:..|:
Mouse   377 GKVTAFKEQYIYPTIVSTERDERSMAQWL 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 70/328 (21%)
PseudoU_synth_ScPus3 103..356 CDD:211336 65/306 (21%)
Pus1NP_001020732.1 TruA 80..377 CDD:223179 73/338 (22%)
PseudoU_synth_PUS1_PUS2 84..354 CDD:211335 65/306 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.