DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and pusl1

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_683563.5 Gene:pusl1 ZFINID:ZDB-GENE-101110-1 Length:291 Species:Danio rerio

Alignment Length:239 Identity:61/240 (25%)
Similarity:95/240 (40%) Gaps:48/240 (20%)


  Fly   152 RTDKEVSAFCQVISIDL--RSKHPPESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLRSP-- 212
            |||..|.|.|....:|:  |:..||         .||......||..|.:.       |:|..  
Zfish    58 RTDTGVHALCNSAHVDIQRRADKPP---------LSEQSLLEALNFQLKEE-------PIRITRA 106

  Fly   213 --VYS---ARFDCVSRTYRYYFPKG---------------------DLDIAAMRKACDLLVRHAD 251
              |:|   ||:...||||.|....|                     .|:|.|||:|..||:...|
Zfish   107 YRVHSDFHARYQAQSRTYVYRLALGCQHHTLMPLTEKDLCWALRDTRLNIDAMREASALLLGTHD 171

  Fly   252 FRNFCKMDVHNGVTNYMRNLQSARVEACDQTNHTNSGYDMYYLEI--QANAFLWHQIRCIMAVLL 314
            |..|..:.........::.|..|::|..:..:..:...|:.:.|:  ::.:||:.|:|.:..||:
Zfish   172 FSTFRALSSDAPFKCPVKTLDLAQLEPGESFSQRHFQRDIQFWELTFKSRSFLYRQVRRMTGVLV 236

  Fly   315 LVGQKKENPGVISDLLDVESNPCKPQYTPAIGLPLNLFRCDFRD 358
            .:||.:.:...|.|||:...:...|....|....|.|....:||
Zfish   237 AIGQGRLSVSKIQDLLEARDSLAFPNNLTAPAHGLFLTNVQYRD 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 61/240 (25%)
PseudoU_synth_ScPus3 103..356 CDD:211336 59/236 (25%)
pusl1XP_683563.5 truA 7..278 CDD:234577 59/236 (25%)
PseudoU_synth_EcTruA 10..278 CDD:211337 59/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126786
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.