| Sequence 1: | NP_611646.1 | Gene: | CG3045 / 37531 | FlyBaseID: | FBgn0034703 | Length: | 499 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_683563.5 | Gene: | pusl1 / 555828 | ZFINID: | ZDB-GENE-101110-1 | Length: | 291 | Species: | Danio rerio |
| Alignment Length: | 239 | Identity: | 61/239 - (25%) |
|---|---|---|---|
| Similarity: | 95/239 - (39%) | Gaps: | 48/239 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 152 RTDKEVSAFCQVISIDL--RSKHPPESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLRSP-- 212
Fly 213 --VYS---ARFDCVSRTYRYYFPKG---------------------DLDIAAMRKACDLLVRHAD 251
Fly 252 FRNFCKMDVHNGVTNYMRNLQSARVEACDQTNHTNSGYDMYYLEI--QANAFLWHQIRCIMAVLL 314
Fly 315 LVGQKKENPGVISDLLDVESNPCKPQYTPAIGLPLNLFRCDFRD 358 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3045 | NP_611646.1 | TruA | 101..376 | CDD:223179 | 61/239 (26%) |
| PseudoU_synth_ScPus3 | 103..356 | CDD:211336 | 59/235 (25%) | ||
| pusl1 | XP_683563.5 | truA | 7..278 | CDD:234577 | 59/235 (25%) |
| PseudoU_synth_EcTruA | 10..278 | CDD:211337 | 59/235 (25%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0101 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_100424 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.710 | |||||