DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and pus1

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001008603.2 Gene:pus1 ZFINID:ZDB-GENE-041212-26 Length:412 Species:Danio rerio

Alignment Length:405 Identity:88/406 (22%)
Similarity:151/406 (37%) Gaps:97/406 (24%)


  Fly    58 KHDKEYSGLIGNEAEGKVSQVAKTSSKVQKIRKFDWSSAH--------------------KRHVL 102
            :|..::|.|.|::.....|....|...|:.:::......|                    |:.|.
Zfish    15 QHLLQFSKLKGDQTRVFCSSFNMTEDSVKAVKRAADDDPHTETEHEDKKLKTDQEERKYPKKKVA 79

  Fly   103 LKITYFGWDYQGFACQEDSND----TIESNLFRAL--ARTCLIESRATS----NYHRCGRTDKEV 157
            |.:.|.|..|.|.  |.::.:    |||..|..||  || |:.|..|..    ::.|..||||.|
Zfish    80 LLMAYSGKGYYGM--QRNARNSQFKTIEDELVTALVGAR-CIPEGHAEEMKKMSFQRSARTDKGV 141

  Fly   158 SAFCQVISIDLRSKHPPESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLRSPVYSARFDCVS 222
            ||..||:|:.:   ...|:.|:.            :|..||..|:.:....:... ::::.:|.:
Zfish   142 SAVGQVVSLKV---WMIENILEK------------INAHLPPQIRVLGCKRVTGG-FNSKNNCYA 190

  Fly   223 RTYRY------YFPKG-DLDIAAMRKACDLLV-----------RHADFRNFCKMDVHN--GVTNY 267
            |||.|      :.||. :.:..:.|...|.|.           .| :|.||.....|.  ....|
Zfish   191 RTYSYMLPTVAFSPKDYNQEDTSFRLTSDTLQTVNRLFGLYKGTH-NFHNFTSQKGHRDPSAMRY 254

  Fly   268 MRNLQSARVEACDQTNHTNSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPGVISDLLDV 332
            :.::      :|.:. ......:...:.::..:|:.||||.::.:::.|.:...:.|||......
Zfish   255 ITHM------SCGEP-FIRKDVEFAVITVRGQSFMMHQIRKMIGLVIAVVKGYVDEGVIEKSWGE 312

  Fly   333 ESNPCKPQYTPAIGLPLNLFRCDFRDHTTRSVNHPSSGDADEEAMDTAADESNDLNAPE-HL--- 393
            |    |.....|.||.|.|.|..|..:..|     ..||...|.::....|....:..| |:   
Zfish   313 E----KVGVPKAPGLGLVLERVHFDGYNKR-----FGGDGIHETLEWTEQEEAIADFKEKHIYPT 368

  Fly   394 -------ERDLTAWI 401
                   |:.:..|:
Zfish   369 IVDTELNEKSMVNWM 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 74/305 (24%)
PseudoU_synth_ScPus3 103..356 CDD:211336 68/283 (24%)
pus1NP_001008603.2 TruA 76..355 CDD:223179 75/315 (24%)
PseudoU_synth_PUS1_PUS2 80..332 CDD:211335 68/283 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.