DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and Pusl1

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001028662.1 Gene:Pusl1 MGIID:3047787 Length:291 Species:Mus musculus

Alignment Length:285 Identity:70/286 (24%)
Similarity:110/286 (38%) Gaps:61/286 (21%)


  Fly   102 LLKITYFGWDYQGFACQEDSNDTIESNLFRALARTCLIESRATS-------NYHRCGRTDKEVSA 159
            |:.:.|.|.|:.|.|       .:..|. ||:.....:|..|..       .:....|||..|.|
Mouse    15 LVFLQYLGTDFNGVA-------AVRGNP-RAVGVLNFLEEAAKRLNSVDPVRFTISSRTDAGVHA 71

  Fly   160 FCQVISIDLRSKHPPESQLDP----TALSSEIDYCGLLNRVLPKNIQCVAWMPLRSP-VYSARFD 219
            ......:|:: :.|.:|...|    .||::.:.:..:  |||         ...|.| .:.||..
Mouse    72 LSNAAHLDIQ-RRPGQSPFSPEVVAKALNTHLKHPAI--RVL---------KAFRVPNDFHARHA 124

  Fly   220 CVSRTYRYYFPKG---------------------DLDIAAMRKACDLLVRHADFRNFCKMDVHNG 263
            ..||||:|....|                     .||:|||::|...|:...||..|  ....:.
Mouse   125 ATSRTYQYRLATGCSWPNQLPVFEQNVCWALQTEYLDMAAMQEAAQHLLGTHDFSAF--QSAGSP 187

  Fly   264 VTNYMRNLQSARVEACDQTNHT----NSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPG 324
            |||.:|.|:...|.....:...    :.....:.||.::.:||:.|:|.:.|||:.||.....|.
Mouse   188 VTNTVRTLRRVSVSPGPASPFVLPEGSRRLQFWTLEFESQSFLYRQVRRMTAVLVAVGLGILAPT 252

  Fly   325 VISDLLDVESNPCKPQ--YTPAIGL 347
            .:..:|:.:....|.|  ..||.||
Mouse   253 QVKVILESQDPLGKYQARVAPARGL 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 70/286 (24%)
PseudoU_synth_ScPus3 103..356 CDD:211336 69/285 (24%)
Pusl1NP_001028662.1 truA 13..284 CDD:234577 70/286 (24%)
PseudoU_synth_EcTruA 18..284 CDD:211337 69/283 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126786
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.