DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and Pus1

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001163664.1 Gene:Pus1 FlyBaseID:FBgn0038811 Length:442 Species:Drosophila melanogaster

Alignment Length:439 Identity:99/440 (23%)
Similarity:175/440 (40%) Gaps:89/440 (20%)


  Fly    12 NKRLKGLSREALEKL-TQTELIDKVIQLEAYNFQLRNLLQKKLSEKDKHD-KEYSGLIGNEAEGK 74
            :|.......|||:|| .:.|...:..:||....:..|.:::.|..|...| ||            
  Fly    26 HKSFAAAMSEALDKLEVEKEARKEAKELEGEAVKDANRIKRTLKRKKWVDWKE------------ 78

  Fly    75 VSQVAKTSSKVQKIRKFDWSSAHKRH---VLLKITYFGWDYQGFACQEDSNDTIESNLFRALART 136
              |..|.::...|...||.:...||.   :||  :|.|.:|.|.. :.....|||..||:|:.:.
  Fly    79 --QDEKDAANGVKRAPFDPADRIKRKKSAILL--SYCGANYYGMQ-RNPGMQTIEEELFKAMLKH 138

  Fly   137 CLI-----ESRATSNYHRCGRTDKEVSAFCQVISIDLRSKHPPESQLDPTALSSEIDYCGLLNRV 196
            ..|     |....|.:.|..||||.|||..||.|:.|     || :||..|.:::          
  Fly   139 KWITEDSFEQIQISCFQRAARTDKGVSAARQVCSVKL-----PE-ELDLEAFNAD---------- 187

  Fly   197 LPKNIQCVAWMPLRSPVYSARFDCVSRTYRYYFP---------KGD-------LDIAAMRKACDL 245
            ||:.|:... :...:..::|:..|.:|||.|..|         |.|       :....::|..:.
  Fly   188 LPQQIRLFG-VERVTKGFNAKDQCNARTYTYTLPTVAFAPFEEKVDDVHDTFRISPELLQKVKET 251

  Fly   246 LVRHADFRNFCKMDVHNGVT--NYMRNLQSARVEACDQTNHTNSGYDMYY--LEIQANAFLWHQI 306
            |..:...:||     ||..:  :::.......:.:...:....|..|:.:  |:::..:|:.|||
  Fly   252 LKLYEGTKNF-----HNFTSKKSFLDPSSKRFIMSFTSSEPFRSPQDIEFVTLKVKGQSFMLHQI 311

  Fly   307 RCIMAVLLLVGQKKENPGVISDLLDVESNPCKPQYTPAIGLPLNLFRCD-FRDHTTR-SVNHPSS 369
            |.::.:.:.:.:.......:...| .|.....|. .|.:||.|:....: :.|...: .:::|.:
  Fly   312 RKMVGLAIAIVRGNTTAATLERAL-TEERLDLPM-APGLGLVLDTVHYERYNDRYGKDGIHNPLT 374

  Fly   370 GDADEEAMDTAADESNDLNAPEHLERDLTAWIYNEENLQKLIENTQCEW 418
            ..|.|..:.            |.:||::.:.||..|..|:    ...:|
  Fly   375 WQAQEAQVQ------------EFIEREIFSQIYKTEAEQR----NMLDW 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 69/302 (23%)
PseudoU_synth_ScPus3 103..356 CDD:211336 64/279 (23%)
Pus1NP_001163664.1 TruA 102..362 CDD:223179 65/287 (23%)
PseudoU_synth_PUS1_PUS2 106..357 CDD:211335 65/278 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C44370250
eggNOG 1 0.900 E1_COG0101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11142
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.