DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and pus3

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_012825699.1 Gene:pus3 XenbaseID:XB-GENE-5897110 Length:536 Species:Xenopus tropicalis

Alignment Length:521 Identity:193/522 (37%)
Similarity:267/522 (51%) Gaps:114/522 (22%)


  Fly    11 INKRLKG---LSREALEKLTQ-----TELIDKVIQLEAYNFQLRNLLQKKLSEKDKHDKEYSGLI 67
            :|.|..|   :|:|  :::||     .||.|||::||.   |.|                     
 Frog    19 LNNRKGGVVTMSQE--DEVTQLRQRVRELEDKVLRLEE---QCR--------------------- 57

  Fly    68 GNEA--EGKVSQVAKTSSKVQKIRKFDWSSAHKRHVLLKITYFGWDYQGFACQEDSNDTIESNLF 130
             .||  :|.|...:.|..|.:..|.||:|:..|:||.|::.|.||.|||||.||::.:|:|..:|
 Frog    58 -GEAPPQGGVQGPSHTKQKQRPQRAFDFSAHPKQHVALRLAYLGWGYQGFASQENTKNTVEETVF 121

  Fly   131 RALARTCLIESRATSNYHRCGRTDKEVSAFCQVISIDLRSKHPPESQLDPTALSSEIDYCGLLNR 195
            .||.:|.|:|||.|||||||||||:.|||..||||:|||.....:         .||.|..:|||
 Frog   122 NALIKTRLVESRQTSNYHRCGRTDRGVSALGQVISLDLRCSGDGK---------PEIRYVHILNR 177

  Fly   196 VLPKNIQCVAWMPLRSPVYSARFDCVSRTYRYYFPKGDLDIAAMRKACDLLVRHADFRNFCKMDV 260
            |||.:|:.::|..: .|.:||||.|.||||||.||...||:.||.||..||....||||.|||||
 Frog   178 VLPPDIRVLSWAAV-PPSFSARFSCRSRTYRYLFPCAQLDVEAMDKAARLLEGTHDFRNLCKMDV 241

  Fly   261 HNGVTNYMRNLQSARVEACDQTNHTNSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPGV 325
            .|||.|::|.:.|||||...:.......:.:|.|:|...|||:||:||||.||.||||.||.|.|
 Frog   242 ANGVMNFIRTVLSARVEPVPEIPGDMGPFQLYRLQITGLAFLYHQVRCIMGVLFLVGQGKEKPEV 306

  Fly   326 ISDLLDVESNPCKPQYTPAIGLPLNLFRCDFRDHTTRSVNHPSSGDADEEAMDTAADESNDLNAP 390
            |::||||..||.||||..|:..||.|:.|.|.|                                
 Frog   307 ITELLDVAKNPRKPQYNMAVEFPLVLYDCHFDD-------------------------------- 339

  Fly   391 EHLERDLTAWIYNEENLQKLIENTQCEWTQFSVKSTMIRNVLQQLENLFEENFKPKEKVLAQVIL 455
                   ..|:..:|.....:.:.|..|||.:||:.|:...:..|:::      |......|.::
 Frog   340 -------VQWVSEKEAQSLTVSHLQRLWTQEAVKTQMLFMAIGGLDSI------PISLETGQDLV 391

  Fly   456 ---------------LQDSVNPRQYQPLLERKRCESLENRIEHFVKKQRLI-------VKNETET 498
                           |.:.|:.|.|.||::|..|:.||.|::|:||:.|:.       ::::|.|
 Frog   392 PWNLCKPTVCDLSGGLVEGVSARSYTPLMKRHLCQGLEERVQHYVKRGRITLPSDRDRLEDKTPT 456

  Fly   499 E 499
            |
 Frog   457 E 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 135/275 (49%)
PseudoU_synth_ScPus3 103..356 CDD:211336 132/253 (52%)
pus3XP_012825699.1 TruA 92..339 CDD:223179 134/257 (52%)
PseudoU_synth_ScPus3 94..337 CDD:211336 132/253 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C44217846
eggNOG 1 0.900 E1_COG0101
Hieranoid 1 1.000
Homologene 1 1.000 H11339
Inparanoid 1 1.050 295 1.000 Inparanoid score I2561
OMA 1 1.010
OrthoDB 1 1.010 D1093493at2759
OrthoFinder 1 1.000 FOG0004172
OrthoInspector 1 1.000 T1061428
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1941
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.