DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and Pusl1

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_017449016.1 Gene:Pusl1 RGDID:1559560 Length:291 Species:Rattus norvegicus

Alignment Length:280 Identity:71/281 (25%)
Similarity:111/281 (40%) Gaps:51/281 (18%)


  Fly   102 LLKITYFGWDYQGFACQEDSNDT--IESNLFRALARTCLIES-RATSNYHRCGRTDKEVSAFCQV 163
            |:...|.|.|:.|.|....::..  :::.|..|..|...:|. |.|.:    .|||..|.|....
  Rat    15 LVFFQYLGTDFNGVAAVRGNHRAVGVQNFLEEAAKRLNSVEPVRFTIS----SRTDAGVHALSNA 75

  Fly   164 ISIDL--RSKHPPES-QLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLRSP-VYSARFDCVSRT 224
            ..:|:  |...||.| ::...||::.:.:..:  |||         ...|.| .:.||....|||
  Rat    76 AHLDIQRRPGRPPFSPEIVTKALNTHLKHPAI--RVL---------KAFRVPNDFHARHAATSRT 129

  Fly   225 YRYYFPKG---------------------DLDIAAMRKACDLLVRHADFRNFCKMDVHNGVTNYM 268
            |.|....|                     .||||||::|...|:...||..|  ....:.|.:.:
  Rat   130 YLYRLATGCSGPNQLPVFEQNVCWSLQTEYLDIAAMQEAAQHLLGTHDFSAF--QSAGSPVPHAV 192

  Fly   269 RNLQSARVEACDQT----NHTNSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPGVISDL 329
            |.|:...|.....:    ...:.....:.||.::.:||:.|:|.:.|||:.||.....|..:..:
  Rat   193 RTLRRVSVSPGPASLFVLPQESRRLQFWTLEFESQSFLYRQVRRMTAVLVAVGLGILAPTQVKVI 257

  Fly   330 LDVESNPCKPQ--YTPAIGL 347
            |:.:....|.|  ..||.||
  Rat   258 LESQDPLGKYQARVAPAHGL 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 71/281 (25%)
PseudoU_synth_ScPus3 103..356 CDD:211336 70/280 (25%)
Pusl1XP_017449016.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.