DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and pus3

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_956361.1 Gene:pus3 ZFINID:ZDB-GENE-030131-9433 Length:460 Species:Danio rerio

Alignment Length:496 Identity:190/497 (38%)
Similarity:260/497 (52%) Gaps:102/497 (21%)


  Fly    10 VINKRLKGLSREALEKLTQTELIDKVIQLEAYNFQLRNLLQKKLSEKDKHDKEYSGLIGNEAEGK 74
            |:..|:|.|..|                ||....|||...::|                      
Zfish     5 VLRVRVKALEEE----------------LERLKAQLRAETEEK---------------------- 31

  Fly    75 VSQVAKTSS--KVQKIRK-FDWSSAHKRHVLLKITYFGWDYQGFACQEDSNDTIESNLFRALART 136
             ||.:::.|  |.|::.| ||:|:..:|||.|::.|.||.|||||.||::::|:|:.||.||.:|
Zfish    32 -SQTSESGSRQKKQRVEKPFDFSAHPRRHVALRLAYLGWQYQGFAVQENTDNTVEARLFEALLKT 95

  Fly   137 CLIESRATSNYHRCGRTDKEVSAFCQVISIDLRSKH---------PPESQLDPTALSSEIDYCGL 192
            .||:.|.||.|||||||||.||||.|||||||||..         |.:..:.....:.|:.|..:
Zfish    96 KLIQDRQTSCYHRCGRTDKGVSAFSQVISIDLRSTQYGGGLGVTVPADVDVKGKTSADELPYVKI 160

  Fly   193 LNRVLPKNIQCVAWMPLRSPVYSARFDCVSRTYRYYFPKGDLDIAAMRKACDLLVRHADFRNFCK 257
            ||||||.:|:.:.|.|:.|. :||||||.|||||||||:||||:..|.:|........||||.||
Zfish   161 LNRVLPHDIRILQWAPVESG-FSARFDCQSRTYRYYFPRGDLDLELMAEAAKRYEGTHDFRNLCK 224

  Fly   258 MDVHNGVTNYMRNLQSARVEACDQTNHT---NSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQK 319
            |||.|||..:.|.:.||.|:.. |..|.   |..:.::..:::..|.|:||:||:||:|||:|||
Zfish   225 MDVGNGVLQFQRTILSASVQPA-QLPHPSVHNDPHQLFVFQVKGLALLYHQVRCMMALLLLIGQK 288

  Fly   320 KENPGVISDLLDVESNPCKPQYTPAIGLPLNLFRCDFRDHTTRSVNHPSSGDADEEAMDTAADES 384
            .|.|.||..|||||.||.||||:.|:..||.|:.|.|.....|                      
Zfish   289 LEAPEVIDQLLDVEKNPRKPQYSMAVDYPLVLYDCHFEGVNWR---------------------- 331

  Fly   385 NDLNAPEHLERDLTAWIYNEENLQKLIENTQCEWTQFSVKSTMIRNVLQQLENLFEENFKPKEKV 449
            |::....|                 ::......|.|.:||:.::..::|.|:|      ...|..
Zfish   332 NEIEEEIH-----------------ILNTFHQHWVQNAVKTQILLGMIQGLQN------TSTEMG 373

  Fly   450 LAQVILLQDSVNPRQYQPLLERKRCESLENRIEHFVKKQRL 490
            ..|..|::.| ..::|||||.|.||||||:||:||||:.||
Zfish   374 SLQCWLMEGS-RQKKYQPLLSRPRCESLESRIQHFVKRGRL 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 135/287 (47%)
PseudoU_synth_ScPus3 103..356 CDD:211336 132/265 (50%)
pus3NP_956361.1 TruA 60..330 CDD:223179 134/272 (49%)
PseudoU_synth_ScPus3 62..325 CDD:211336 132/265 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C44219454
eggNOG 1 0.900 E1_COG0101
Hieranoid 1 1.000
Homologene 1 1.000 H11339
Inparanoid 1 1.050 304 1.000 Inparanoid score I2595
OMA 1 1.010
OrthoDB 1 1.010 D1093493at2759
OrthoFinder 1 1.000 FOG0004172
OrthoInspector 1 1.000 T1054627
orthoMCL 1 0.900 OOG5_126786
Panther 1 1.100 LDO PTHR11142
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1941
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.