DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and Pus3

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001101604.1 Gene:Pus3 RGDID:1310757 Length:479 Species:Rattus norvegicus

Alignment Length:471 Identity:188/472 (40%)
Similarity:262/472 (56%) Gaps:68/472 (14%)


  Fly    46 RNLLQKKLSEKDKHDKEYSGLIGNEAEG-KVSQVAKTSSKVQKI-RKFDWSSAHKRHVLLKITYF 108
            ||.::|.||...:.::|...|...:|.. |.:.|.:.|....|. |.||:|:..:|||.|||.|.
  Rat     7 RNQIEKLLSRVKELEQEVERLKKEQANNIKDTSVRENSLGCGKAKRAFDFSAHGRRHVALKIAYL 71

  Fly   109 GWDYQGFACQEDSNDTIESNLFRALARTCLIESRATSNYHRCGRTDKEVSAFCQVISIDLRSKHP 173
            ||.|||||.||::::|||..||.||.:|.|:|||.||||||||||||.||||.||||:||||:.|
  Rat    72 GWGYQGFASQENTSNTIEEKLFEALIKTRLVESRQTSNYHRCGRTDKGVSAFGQVISLDLRSQFP 136

  Fly   174 -----PESQLDPTA--LSSEIDYCGLLNRVLPKNIQCVAWMPLRSPVYSARFDCVSRTYRYYFPK 231
                 .:|.|...|  ::.||.|..:||||||.:|:.:||.| ..|.:||||.|:.|||||:||.
  Rat   137 RSRDSEDSNLKDGADDIAKEIRYAHILNRVLPADIRVLAWAP-AEPSFSARFSCLERTYRYFFPC 200

  Fly   232 GDLDIAAMRKACDLLVRHADFRNFCKMDVHNGVTNYMRNLQSARVEACDQT---NHTNSGYDMYY 293
            .|||||.|..|....|...||||.|||||.|||||:.|.:.||:|:...|:   ......:.:..
  Rat   201 ADLDIATMNYAAQKYVGTHDFRNLCKMDVANGVTNFQRTILSAQVQTVAQSPGEEGRQGPFQLCQ 265

  Fly   294 LEIQANAFLWHQIRCIMAVLLLVGQKKENPGVISDLLDVESNPCKPQYTPAIGLPLNLFRCDFRD 358
            .|:...|||:||:||:||:|.|:||..|.|.:|.:||::|.||.||||:.|:..||.|:.|.|.:
  Rat   266 FEVIGQAFLYHQVRCMMAILFLIGQGMEKPEIIDELLNIEKNPQKPQYSMAVEFPLVLYDCKFEN 330

  Fly   359 HTTRSVNHPSSGDADEEAMDTAADESNDLNAPEHLERDLTAWIYNEENLQKLIENTQCEWTQFSV 423
                                                   |.|||:.|..:..:.:.|..|...:|
  Rat   331 ---------------------------------------TKWIYDHEVHEFNVTHLQQLWANHAV 356

  Fly   424 KSTMIRNVLQQLENLFE--------------ENFKPKEKVLAQVILLQDSVNPRQYQPLLERKRC 474
            |:.|:.::||.|:::..              .|.:|  .|:.......:.|..|.|:||:.|.:|
  Rat   357 KTHMLYSMLQGLDSVMVTCAAGTKTGEATEWRNIRP--SVIKHTSAFVEGVRMRTYKPLMARPKC 419

  Fly   475 ESLENRIEHFVKKQRL 490
            :.||:||:|||::.|:
  Rat   420 QGLESRIQHFVRRGRI 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 139/285 (49%)
PseudoU_synth_ScPus3 103..356 CDD:211336 137/263 (52%)
Pus3NP_001101604.1 TruA 64..334 CDD:223179 141/310 (45%)
PseudoU_synth_ScPus3 66..328 CDD:211336 137/263 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C44219390
eggNOG 1 0.900 E1_COG0101
Hieranoid 1 1.000
Homologene 1 1.000 H11339
Inparanoid 1 1.050 316 1.000 Inparanoid score I2439
OMA 1 1.010
OrthoDB 1 1.010 D1093493at2759
OrthoFinder 1 1.000 FOG0004172
OrthoInspector 1 1.000 T1089035
orthoMCL 1 0.900 OOG5_126786
Panther 1 1.100 LDO PTHR11142
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.