DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3045 and Y73B6BL.29

DIOPT Version :9

Sequence 1:NP_611646.1 Gene:CG3045 / 37531 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_500962.1 Gene:Y73B6BL.29 / 260252 WormBaseID:WBGene00022250 Length:322 Species:Caenorhabditis elegans


Alignment Length:320 Identity:67/320 - (20%)
Similarity:109/320 - (34%) Gaps:87/320 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 RHVLLKITYFGWDY-------QGFACQEDSNDTIESNLFRALARTCLIESRATSN------YHRC 150
            |..|..|.|.|..:       .||...:..|.||.:::|.:       ....|.|      :...
 Worm     5 RRYLFWIGYDGSKFPEMAKGGTGFGVMDLLNQTISTSIFGS-------RCEQTPNCSDRLKFSPS 62

  Fly   151 GRTDKEV-----SAFCQV----ISIDLRSKHPPESQLDPTALSSEIDYCGLLNRVLPKNIQ---- 202
            .|||.:|     |..|||    ..:|   |.|...:...|:..:.||...      |.:::    
 Worm    63 SRTDAKVHAIRNSVICQVPLEYAELD---KTPETKKAFMTSWKNTIDVAN------PGSLEIHDV 118

  Fly   203 ------------------------CVAWMPLRSPVYSARFDCVS-RTYRYYFPKGDLDIAAMRKA 242
                                    |.:|....|........|.| |.|.:..|.| .....:.:|
 Worm   119 HSVSAGFCIRRSVSYRKYTYRMAVCRSWELWESIRQEPSISCFSERDYAWRLPPG-FSAHKVLQA 182

  Fly   243 CDLL----VRHADFRNFCKMDVHNGVT----NYMRNLQSARVEACDQTNHTNSGYDMYYLEIQAN 299
            ..|.    |..:.|::..:...:..::    .|:.::..::.||....|..   ||.|.:.|.|.
 Worm   183 GKLFEGEQVMGSFFKHTAREKRYEPISPTALKYIFHVGLSKGEAYSMENDI---YDYYNVTIVAK 244

  Fly   300 AFLWHQIRCIMAVLLLVGQKKENPGVISDLLDVESNPCKPQYTPAIGLPL----NLFRCD 355
            :|:..|||.:|:.|:.....:.....|..||   |||....:.. :|:|:    .||..|
 Worm   245 SFVREQIRRMMSCLVNYSYDRIPLTTIEWLL---SNPISSNFFD-LGIPVAPPQGLFLTD 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 66/318 (21%)
PseudoU_synth_ScPus3 103..356 CDD:211336 65/316 (21%)
Y73B6BL.29NP_500962.1 TruA 5..315 CDD:223179 67/320 (21%)
PseudoU_synth 62..303 CDD:294089 54/256 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100424
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.