DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and SPAC25B8.05

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_594465.1 Gene:SPAC25B8.05 PomBaseID:SPAC25B8.05 Length:450 Species:Schizosaccharomyces pombe

Alignment Length:510 Identity:157/511 (31%)
Similarity:236/511 (46%) Gaps:101/511 (20%)


  Fly    17 GLSREALEKLTQTELIDKVIQLEAYNFQLRNLLQKK--------LSEKDKHDKEYSGLIGNEAEG 73
            |.||:        :||.::::|:....:..|.|..|        :..|:|.|.      |||.|.
pombe     8 GWSRD--------QLISRILELDGKLQKNTNSLPNKEIEGKNEVIKNKNKLDN------GNEIEP 58

  Fly    74 K----------VSQVAKTSSKVQKIRKFDWSSAHKRHVLLKITYFGWDYQGFACQEDSN--DTIE 126
            :          ..|.|.:..|::.:|.|.....  ..|..|..|.||:|.|.|.|.:..  .|:|
pombe    59 QHLSQELVLQHALQDASSLPKLKPVRPFQLEKT--VFVAFKFAYCGWNYNGLAYQLEPTPLPTVE 121

  Fly   127 SNLFRALARTCLIESRATSNYHRCGRTDKEVSAFCQVISIDLRSKHPPESQLDPTALSSEIDYCG 191
            ..:|.||.|..||...::.::.|||||||.|||..||||:::|     .|:..|      |.||.
pombe   122 GKVFEALLRAHLITDPSSCSFSRCGRTDKGVSAMGQVISLNVR-----HSERRP------IIYCD 175

  Fly   192 LLNRVLPKNIQCVAW-MPLRSPVYSARFDCVSRTYRYYF----PKGDLDIAAMRKACDLLVRHAD 251
            :|||:||.:|:...: .|...  :.|||.|..|.|:|.|    |.|.|||..|.:|..|.:...|
pombe   176 VLNRLLPADIRITGYAFPPEG--FDARFSCKQRHYKYLFTKDYPGGSLDIDRMNEAAALYLGEHD 238

  Fly   252 FRNFCKMDVHNGVTNYMRNLQSARVEACDQTNHTNSGYDMYYLEIQANAFLWHQIRCIMAVLLLV 316
            ||||||:|....:|||.|.:.|::|...|.:.      .:|..::|..||||||:||:||:|.|:
pombe   239 FRNFCKIDASKQITNYHRRILSSKVICIDPST------GLYAFDLQGTAFLWHQVRCMMAILFLI 297

  Fly   317 GQKKENPGVISDLLDVESNPCKPQYTPAIGLPLNLFRCDFRDHTTRSVNHPSSGDADEEAMDTAA 381
            |||.|...:|:||||::..|.||.|..|...||.|:.|||              |..|..:.|  
pombe   298 GQKLEPASLINDLLDIKKVPTKPIYDMASEYPLILYDCDF--------------DNIEWTLPT-- 346

  Fly   382 DESNDLNAPEHLERDLTAWIYNEENLQKLIENTQCEWTQFSVKSTMIRNVLQQLENLFEENFKPK 446
              .:...|| .:.:.....||:             :|....::..:...:|...::..:...|.:
pombe   347 --DSPTTAP-RIAKHTYETIYH-------------QWHSLRIREQIASFMLDIADHNVKRYGKSE 395

  Fly   447 EKVLAQVI---LLQDSVNPRQYQPLLERKRCESLENRIEHFVKKQRL---IVKNE 495
            |......:   ||:   ..::|.|:|.|:|.||:|...|.:.:|:.|   .||:|
pombe   396 ESSSTMNVGEGLLK---RTKKYIPILSRQRQESVEVVNERYKRKKGLKDSDVKSE 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 111/282 (39%)
PseudoU_synth_ScPus3 103..356 CDD:211336 107/260 (41%)
SPAC25B8.05NP_594465.1 TruA 93..359 CDD:223179 114/304 (38%)
PseudoU_synth_ScPus3 96..337 CDD:211336 107/260 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H11339
Inparanoid 1 1.050 190 1.000 Inparanoid score I1037
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004172
OrthoInspector 1 1.000 T1125906
orthoMCL 1 0.900 OOG5_126786
Panther 1 1.100 LDO PTHR11142
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1941
TreeFam 1 0.960
109.950

Return to query results.
Submit another query.