DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and pus-1

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_507242.1 Gene:pus-1 WormBaseID:WBGene00004248 Length:415 Species:Caenorhabditis elegans

Alignment Length:451 Identity:90/452 (20%)
Similarity:159/452 (35%) Gaps:144/452 (32%)


  Fly    85 VQKIRKFDWSSAHK----------RHVLLKITYFGWDYQGFACQEDSNDTIESNLFRALARTCLI 139
            |.|:........||          ::.:| :.|.|..|.|...|:|. .||||.|..|:.....|
 Worm    10 VDKLNHVQSGGVHKEPKKPRVKQAKYAML-LGYQGKKYYGMQLQKDL-PTIESKLLEAMETAGWI 72

  Fly   140 ESRATSN-----YHRCGRTDKEVSAFCQVISIDL---RSKHPPESQLDPTALSSEIDYCGLLNRV 196
            .:.....     :.|..|||:.|||..|:..:.|   .:|:..|.             .|:||.:
 Worm    73 TTAQKEKPFDFFFQRAARTDRAVSAARQMCGMQLPRDDAKYQAEG-------------AGILNNI 124

  Fly   197 LPKNIQCVAWMPLRSPVYSARFDCVSRTYRYYFPK------GDLDIAAMRKACDLLVRHADFRNF 255
            ||.:|: |..|...:..:..:..|..|||.|..|.      .:|..::.|.:.:.|   |:..:.
 Worm   125 LPADIR-VFGMRRTTNFFHPQKQCDHRTYSYTCPSFVFAKPTELTNSSFRLSPETL---AEVNSI 185

  Fly   256 CKMDVHNGVTNYMRNLQSARVEACDQTNHTNSGY---------------DMYYLE--IQANAFLW 303
              :.::.|..|:. |..:.|......:|.....:               |:.:::  |:..:|:.
 Worm   186 --LSIYLGTHNFF-NYTAKRAYDDMSSNRYIISFECKEPFLFRDDFRKEDVEFVQIVIKGQSFVL 247

  Fly   304 HQIRCIMAVLLLV---------------GQKKENPGVISDLLDVESNPCKPQYTPAIGLPLNLFR 353
            ||||.::.:::.|               ||:.:.|                 ..|.:||.|....
 Worm   248 HQIRKMVGMVITVIRELHLKSSIQRSFEGQRMDIP-----------------MAPGLGLLLERTH 295

  Fly   354 CDFRDHTTRSVNHPSSGDADEEAMDTAADESNDLNAPEHLERDLTAWIYNEENLQKLIENTQCEW 418
            .|..|......:.|                             ||.|   .|.::|.||.|:.|.
 Worm   296 YDSYDRKNSKSHEP-----------------------------LTDW---GEIIEKEIERTKFEL 328

  Fly   419 -TQFSVKSTMI-RNVLQQLENLFEENF-------KPKEKVLAQVILL--------QDSVNP 462
             |:..:::.:: :.:|:.|.:|...:|       :|::|....:...        ||.|.|
 Worm   329 ITKDMIETELLTQGMLKWLADLVHHDFTANAEAEEPEKKTFVTMAAACASKAAKEQDGVAP 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 66/321 (21%)
PseudoU_synth_ScPus3 103..356 CDD:211336 64/299 (21%)
pus-1NP_507242.1 TruA 34..320 CDD:223179 71/357 (20%)
PseudoU_synth_PUS1_PUS2 37..296 CDD:211335 63/298 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.