DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and tag-124

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_496062.3 Gene:tag-124 WormBaseID:WBGene00006473 Length:402 Species:Caenorhabditis elegans

Alignment Length:439 Identity:140/440 (32%)
Similarity:221/440 (50%) Gaps:59/440 (13%)


  Fly    74 KVSQVAKTSSKVQKIRKFDWSSAHKRHVLLKITYFGWDYQGFACQEDSNDTIESNLFRALARTCL 138
            :|...|..|.|.:|.:..|:.:..:|.:.::..|.||::.|...|..:.:|:|:::.:||.:|.|
 Worm     5 RVCPDANNSVKSKKAKTLDFLAHPRRKIAIQFFYLGWEHDGLVQQPHTQNTVENHIMQALIKTHL 69

  Fly   139 IESRATSNYHRCGRTDKEVSAFCQVISIDLRSKHPPES------------QLDPTALSSEIDYCG 191
            ||.....::.|||||||.||||.|..::.:||..|.:|            ::|..|...|:.|..
 Worm    70 IEDWTKCDFSRCGRTDKGVSAFKQTAAMVVRSLCPGDSGVFWSDSTQEHQKVDYKASGEELPYVK 134

  Fly   192 LLNRVLPKNIQCVAWMPLRSPVYSARFDCVSRTYRYYFPKGDLDIAAMRKACDLLVRHADFRNFC 256
            :||.||||.|:..||.|: :..::|||||..|||:|.|.|.||::..||:..:|||...||.|||
 Worm   135 MLNGVLPKTIRVFAWAPV-AQTFNARFDCNRRTYKYSFAKADLNLEKMRQGAELLVGEHDFSNFC 198

  Fly   257 KMDVHNG--VTNYMRNLQSARVEACDQTNHTNSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQK 319
            ::|::..  :.:|:|.:...:||.. .|:..|..|.|..|.:..:.||||.||.|:.:|..:|::
 Worm   199 QIDMNEKRLLQSYVRKVYEVKVEQV-STHPENDMYSMVELTVSGSGFLWHMIRYIVTILQEIGRE 262

  Fly   320 KENPGVISDLLDVESNPCKPQYTPAIGLPLNLFRCDFRDHTTRSVNHPSSGDADEEAMDTAADES 384
            .|.|.:||.|||::..|.:||||.|...||.||.|.::                          |
 Worm   263 NEQPSLISQLLDLKKYPSRPQYTLASDTPLCLFDCGYK--------------------------S 301

  Fly   385 NDLNAPEHLERDLTAWIYNEENLQKLIENTQCEWTQFSVKSTMIRNVLQQLENLFEENFKPKEKV 449
            .|:.           |..::..|:..:...|..|..:..:|.|:.|:|.:|..:.|.:.....|.
 Worm   302 EDVE-----------WKVHDYTLKSTVTGLQKTWATYQARSRMMENMLGELTGMAEFSSGDANKG 355

  Fly   450 LAQVILLQDSVNPRQYQPLLERKRCESLENRIEHFVKKQRLIVKNETET 498
            |.:.:  ||...|..|.....||.|||||::.|...:|:    ||..|:
 Worm   356 LHEFV--QDRPIPSNYIRFENRKMCESLESKKEKMAEKK----KNGEES 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 103/289 (36%)
PseudoU_synth_ScPus3 103..356 CDD:211336 103/267 (39%)
tag-124NP_496062.3 TruA 30..299 CDD:223179 104/271 (38%)
PseudoU_synth_ScPus3 34..299 CDD:211336 103/267 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C44222630
eggNOG 1 0.900 E1_COG0101
Hieranoid 1 1.000
Homologene 1 1.000 H11339
Inparanoid 1 1.050 224 1.000 Inparanoid score I2221
Isobase 1 0.950 0 Normalized mean entropy S1490
OMA 1 1.010
OrthoDB 1 1.010 D1093493at2759
OrthoFinder 1 1.000 FOG0004172
OrthoInspector 1 1.000 T476422
orthoMCL 1 0.900 OOG5_126786
Panther 1 1.100 LDO PTHR11142
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1941
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.