DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and pusl1

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_012822593.1 Gene:pusl1 XenbaseID:XB-GENE-991885 Length:291 Species:Xenopus tropicalis

Alignment Length:279 Identity:61/280 (22%)
Similarity:109/280 (39%) Gaps:36/280 (13%)


  Fly    98 KRHVLLKITYFGWDYQGFACQEDSNDTIESNLFRALARTCLIESRATSNYHRCGRTDKEVSAFCQ 162
            |...|:...|:|..|.|......:...:....:..:|...| ....|..:....|||..|.|.|.
 Frog     5 KARYLVFFQYYGTKYSGVMETPVTQSVLGVQNYLEMAAQKL-RPVGTVKFFISSRTDSGVHAICN 68

  Fly   163 VISIDLRSKH--PPESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLRSPVYSARFDCVSRTY 225
            ...:|::..:  ||        .:.:|....|.:.:.|:.|:.:..:.: ...:.||...:||||
 Frog    69 SAHVDIQRANGKPP--------FTEDILVQALNHHLQPEPIRLLKAVRV-CDNFHARHKALSRTY 124

  Fly   226 RY-------------------YFPKGDLDIAAMRKACDLLVRHADFRNFCKMDVHNGVTNYMRNL 271
            .|                   :...|.|::||:.:|.::|:...:|..|...:..|...:.::.|
 Frog   125 VYRVAAGCSHSELPVFEENLCWAVPGSLNVAAIHEASEMLLGTHNFSAFRSANSENVFKSPIKTL 189

  Fly   272 QSARVEACD--QTNHTN-SGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPGVISDLLDVE 333
            |.|.:....  .|:|.. .....:....:|.:||:.|:|.:...|:.|||.:..|..|.:.|:.:
 Frog   190 QQADITPSSGILTHHWQYRNLQFWDFTFRARSFLYKQVRRMTGALVAVGQGRLTPLQIKEFLENQ 254

  Fly   334 SNPCK--PQYTPAIGLPLN 350
            ...|.  ....|..||.||
 Frog   255 DPNCTLGNFVAPPHGLFLN 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 60/277 (22%)
PseudoU_synth_ScPus3 103..356 CDD:211336 59/275 (21%)
pusl1XP_012822593.1 truA 7..277 CDD:234577 60/278 (22%)
PseudoU_synth_EcTruA 12..277 CDD:211337 59/273 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.