DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3045 and pus1

Sequence 1:NP_611646.1 Gene:CG3045 FlyBaseID:FBgn0034703 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_002931922.1 Gene:pus1 XenbaseID:XB-GENE-963672 Length:399 Species:Xenopus tropicalis

Alignment Length:418 Identity:93/419 (22%)
Similarity:170/419 (41%) Gaps:95/419 (23%)


  Fly    60 DKEYSGLIGNEAEGKVSQ--VAKTSSKVQ-----KIRKF-----DWSSAH-KRHVLLKITYFGWD 111
            |.|...|:.|...|.:.:  |.:..|:.|     :.:||     :.|..| ||.|:|.:.|.|..
 Frog     3 DPEKESLLKNVTTGDIRKACVLQEESEGQEKNGHQAKKFKADQEELSKKHPKRKVVLLMAYSGKG 67

  Fly   112 YQGFACQEDSND--TIESNLFRALART-CLIESRATS----NYHRCGRTDKEVSAFCQVISIDLR 169
            |.|......|:.  |||..|.:||..: |:.::.|..    ::.||.||||.|||..||:|:.: 
 Frog    68 YHGMQRNVGSSQFKTIEDELVQALVLSGCIPDNHAEDMKKMSFQRCARTDKGVSAAGQVVSLKI- 131

  Fly   170 SKHPPESQLDPTALSSEIDYCGLLNRVLPKNIQCVAWMPLRSPVYSARFDCVSRTYRYYFP---- 230
                       ..:.:.::   .:|..||.:|:.:....:... ::::..|.:|||.|..|    
 Frog   132 -----------WLIDNVVE---KINENLPSHIRILGLKRVTGR-FNSKNSCDARTYSYTLPTFAF 181

  Fly   231 ----------KGDLDIAAMRKACDLLVRHADFRNFCKMDVHNGVTNYMRNLQSAR---VEACDQT 282
                      ...|....:.:..:||..:...|||     ||..:.......||:   :|...:.
 Frog   182 SHKDKEAQDENFRLSQETLNRVNELLALYKGTRNF-----HNFTSQKGPRDPSAKRYIMEMHCEP 241

  Fly   283 NHTNSGYDMYYLEIQANAFLWHQIRCIMAVLLLVGQKKENPGVI-----SDLLDVESNPCKPQYT 342
            .....|.::..::::..:|:.||||.::.:::.|.:......:|     .:.:|:...|      
 Frog   242 PFQQGGLELAVIKVKGQSFMMHQIRKMIGLVIAVVKGFAPTSIIERSWGEEKVDIPKAP------ 300

  Fly   343 PAIGLPLNLFRCDFRDHTTRSVNHPSSGDADEEAMD-TAADESNDLNAPEHL----------ERD 396
               ||.|.|.|..|..:..|..|     |...|::: |..:|..:....||:          |:.
 Frog   301 ---GLGLVLERVHFEKYNRRFGN-----DGLHESLNWTEEEEKIESFKKEHIYPTIIQTEIDEKS 357

  Fly   397 LTAWI-------YNEENLQKLIENTQCE 417
            :.||:       |:..::|:..:|.:.|
 Frog   358 MLAWLATLPIHDYDATSVQQNQDNHKAE 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3045NP_611646.1 TruA 101..376 CDD:223179 68/304 (22%)
PseudoU_synth_ScPus3 103..356 CDD:211336 62/282 (22%)
pus1XP_002931922.1 TruA 55..334 CDD:223179 70/314 (22%)
PseudoU_synth_PUS1_PUS2 59..311 CDD:211335 62/282 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.