DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Synj and Synj1

Sequence 1:NP_001246454.1 Gene:Synj FlyBaseID:FBgn0034691 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_445928.2 Gene:Synj1 RGDID:69434 Length:1292 Species:Rattus norvegicus

Alignment Length:1322 Identity:631/1323 (48%)
Similarity:819/1323 (62%) Gaps:152/1323 (11%)


  Fly     1 MAMSKVIRVLEKSIAPSPHSVLLEHRNKSDSILFESHAVALLTQQETDVIRKQYTKVCDAYGCLG 65
            ||.||..|:..| :.|.|.|:::|.|:|.:.::|||.|||:|:..|.:.|:..|.||.||||.||
  Rat     1 MAFSKGFRIYHK-LDPPPFSLIVETRHKEECLMFESGAVAVLSSAEKEAIKGTYAKVLDAYGLLG 64

  Fly    66 ALQLNAGESTVLFLVLVTGCVSMGKIGDIEIFRITQTTFVSLQNAAPNEDKISEVRKLLNSGTFY 130
            .|:||.|::.:.:|||||||:|:|||.:.|:||:|.|.|:||:..|.:||:||||||:||||.||
  Rat    65 VLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRVDASDEDRISEVRKVLNSGNFY 129

  Fly   131 FAHTNASASASGASSYRFDITLCAQRRQQTQETDNRFFWNRMMHIHLMRFGIDCQSWLLQAMCGS 195
            ||.     ||||.|   .|::|.|.|..|...||||||||:.:|:||..:|::|..|||:.|||.
  Rat   130 FAW-----SASGVS---LDLSLNAHRSMQEHTTDNRFFWNQSLHLHLKHYGVNCDDWLLRLMCGG 186

  Fly   196 VEVRTVYIGAKQARAAIISRLSCERAGTRFNVRGTNDEGYVANFVETEQVIYVDGDVTSYVQTRG 260
            ||:||:|...|||:|.:||||||||||||||||||||:|:||||||||||||:|..|:|::|.||
  Rat   187 VEIRTIYAAHKQAKACLISRLSCERAGTRFNVRGTNDDGHVANFVETEQVIYLDDCVSSFIQIRG 251

  Fly   261 SVPLFWEQPGVQVGSHKVKLSRGFETSAAAFDRHMSMMRQRYGYQTVVNLLGSSLVGSKEGEAML 325
            ||||||||||:|||||:|::|||||.:|.|||||...::..||.|.|||||     ||||||.||
  Rat   252 SVPLFWEQPGLQVGSHRVRMSRGFEANAPAFDRHFRTLKDLYGKQIVVNLL-----GSKEGEHML 311

  Fly   326 SNEFQRHHGMSAH-KDVPHVVFDYHQECRGGNFSALAKLKERIVACGANYGVFHASNGQVLREQF 389
            |..||.|...|.| .|:..|.|||||..:||....|..:.:..|....:||.|:.....|.|.|.
  Rat   312 SKAFQSHLKASEHASDIHMVSFDYHQMVKGGKAEKLHSVLKPQVQKFLDYGFFYFDGSAVQRCQS 376

  Fly   390 GVVRTNCLDCLDRTNCVQTYLGLDTLGIQLEALKMGGKQQNISRFEEIFRQMWINNGNEVSKIYA 454
            |.|||||||||||||.||.:|||:.|..|||||.:..|.|.::||:|:||.||..||:.:|||||
  Rat   377 GTVRTNCLDCLDRTNSVQAFLGLEMLAKQLEALGLAEKPQLVTRFQEVFRSMWSVNGDSISKIYA 441

  Fly   455 GTGAIQGGSKLMDGARSAARTIQNNLLDNSKQEAIDVLLVGSTLSSELADRARILLPSNMLH--- 516
            ||||::|.:||.|||||..||||||..|:||||||||||:|:||:|:|||:||.||.:..|.   
  Rat   442 GTGALEGKAKLKDGARSVTRTIQNNFFDSSKQEAIDVLLLGNTLNSDLADKARALLTTGSLRVSE 506

  Fly   517 -----APTTVLRELCKRYTEYVRPRMARVAVGTYNVNGGKHFRSIVFKD-SLADWLLDCHALARS 575
                 |.:.||:.:|:.:.:|.:|:..||.|||:||||||.||||.||: :|.|||||...||..
  Rat   507 QTLQSASSKVLKNMCENFYKYSKPKKIRVCVGTWNVNGGKQFRSIAFKNQTLTDWLLDAPKLAGI 571

  Fly   576 KALVDVNNPSENVDHPVDIYAIGFEEIVDLNASNIMAASTDNAKLWAEELQKTISRDNDYVLLTY 640
            :...|..:      .|.||:||||||:|:|||.||:.|||.|.||||.||||||||||.||||..
  Rat   572 QEFQDKRS------KPTDIFAIGFEEMVELNAGNIVNASTTNQKLWAVELQKTISRDNKYVLLAS 630

  Fly   641 QQLVGVCLYIYIRPEHAPHIRDVAIDCVKTGLGGATGNKGACAIRFVLHGTSMCFVCAHFAAGQS 705
            :|||||||:::|||:|||.|||||:|.||||:|||||||||.|||.:.|.||:||||:|||||||
  Rat   631 EQLVGVCLFVFIRPQHAPFIRDVAVDTVKTGMGGATGNKGAVAIRMLFHTTSLCFVCSHFAAGQS 695

  Fly   706 QVAERNADYAEITRKLAFPMGRTLKSHDWVFWCGDFNYRIDMEKDELKECVRNGDLSTVLEFDQL 770
            ||.|||.|:.||.|||:|||||.|.|||:||||||||||||:..:|:||.:|..:..:::..|||
  Rat   696 QVKERNEDFVEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAGDQL 760

  Fly   771 RKEQEAGNVFGEFLEGEITFDPTYKYDLFSDDYDTSEKQRAPAWTDRVLWRRRK----------A 825
            ..::.||.:|..||||::||.|||||||||:|||||||.|.|||||||||||||          .
  Rat   761 INQKNAGQIFRGFLEGKVTFAPTYKYDLFSEDYDTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLD 825

  Fly   826 LAEGDFAASA-----WNPGKLIHYGRSELKQSDHRPVIAIIDAEIMEIDQQRRRAVFEQVIRDLG 885
            |....|...:     |.||.|:||||:|||.||||||:|:||.:|.|::.:.|:.::::||...|
  Rat   826 LLNASFQDESKILYTWTPGTLLHYGRAELKTSDHRPVVALIDIDIFEVEAEERQKIYKEVIAVQG 890

  Fly   886 PPDSTIVVHVLESSATGDEDGPTIYDENVMSALITELSKMGEVTLVRYVEDTMWVTFRDGESALN 950
            |||.|::|.: :|||..:    |.:|:.::..|:.:.:..|||.|:|:|||.|||||.:|.||||
  Rat   891 PPDGTVLVSI-KSSAQEN----TFFDDALIDELLQQFAHFGEVILIRFVEDKMWVTFLEGSSALN 950

  Fly   951 ASSKKSIQVCGLDLILELKSKDWQHLVDSEIELCTTN-TIPLCANPV---EHAQLLQAITPE--- 1008
            ..|....::....:.:.|||.||...::.|:.|...: |:|...:..   |.|::......|   
  Rat   951 VLSLNGKELLNRTITITLKSPDWIKTLEEEMSLEKISVTLPSSTSSTLLGEDAEVSADFDMEGDV 1015

  Fly  1009 ----------LPQR--------------------PKQPPTRPP-ARPPMPMSPKNSPRHLPHVGV 1042
                      |||.                    |.|.||.|. :.|.:|:.|..:|...|  |.
  Rat  1016 DDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQSPTAPEYSAPSLPIRPSRAPSRTP--GP 1078

  Fly  1043 IS-----IVPKPA-----------KPPMPPQPQSQPLIPSPLQPQVAPPRPPAMDTTPSSK---- 1087
            :|     :..:||           |.|.||:|.:.|..|:|  ||..||...|....|:.|    
  Rat  1079 LSSQGAPVDTQPAAQKESSQTIEPKRPPPPRPVAPPARPAP--PQRPPPPSGARSPAPARKEFGA 1141

  Fly  1088 --------------SQSPTELVSASSSTSSSGKTSPTAPA---VLSGPPTPPRQMQSK-----QA 1130
                          :|...:...|....|..|...||.||   |:|.|.:..|....:     |:
  Rat  1142 PKSPGTARKDNIGRNQPSPQAGLAGPGPSGYGAARPTIPARAGVISAPQSQARVSAGRLTPESQS 1206

  Fly  1131 TPVSTPTRQVGSPKDPIPSDTAYETASNIYEEIQEDVPAPRHPPPA----GPPPVIGAPMGPPPP 1191
            .|:.|.......| :|:....|:.             |.|..|.||    .|...|.|||.|..|
  Rat  1207 KPLETSKGPAVLP-EPLKPQAAFP-------------PQPSLPTPAQKLQDPLVPIAAPMPPSIP 1257

  Fly  1192 LPNRRGPPPIPNRSGNAPPLPT 1213
            ..|...||..|.||.::..||:
  Rat  1258 QSNLETPPLPPPRSRSSQSLPS 1279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SynjNP_001246454.1 Syja_N 61..353 CDD:280532 177/293 (60%)
INPP5c_Synj 538..863 CDD:197323 212/341 (62%)
DUF1866 862..1008 CDD:286093 48/150 (32%)
Synj1NP_445928.2 Syja_N 60..340 CDD:280532 177/293 (60%)
Catalytic. {ECO:0000255} 500..899 230/405 (57%)
INPP5c_Synj1 533..868 CDD:197332 212/341 (62%)
RRM_SF 867..1009 CDD:302621 48/147 (33%)
PHA02777 1168..>1258 CDD:165142 28/104 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C83885015
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H48252
Inparanoid 1 1.050 1102 1.000 Inparanoid score I211
OMA 1 1.010
OrthoDB 1 1.010 D359616at2759
OrthoFinder 1 1.000 FOG0001373
OrthoInspector 1 1.000 T618076
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11200
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.