DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Synj and syj1

Sequence 1:NP_001246454.1 Gene:Synj FlyBaseID:FBgn0034691 Length:1218 Species:Drosophila melanogaster
Sequence 2:NP_596431.1 Gene:syj1 PomBaseID:SPBC2G2.02 Length:1076 Species:Schizosaccharomyces pombe

Alignment Length:1204 Identity:370/1205 (31%)
Similarity:547/1205 (45%) Gaps:261/1205 (22%)


  Fly    18 PHSVLLEHRNKSDSILFES-----HAVALLTQQETDVIRKQ---YTKVCD--AYGCLGALQLNAG 72
            |.|:.|.  ||..:::|.|     :::::...:.|.:..|.   :.|:..  .||.||.::|...
pombe     9 PRSLALV--NKDHALMFHSVPQNKNSLSVCVAEFTALSEKPLEGFRKISSHRIYGTLGLIELEGS 71

  Fly    73 ESTVLFLVLVTGCVSMGKIGDIE-IFRITQTTFVSL----------QNAAPN------------- 113
            .    ||.:::|...:.::.|.| :|||.:..|.|:          :|.:|:             
pombe    72 N----FLCVISGASEVARVRDKERVFRIMEVCFYSVNRSNWDHIRQENYSPDIPDGYDTDTQGYD 132

  Fly   114 -----EDKISEVRKLLNSGTFYFAHTNASASASGASSYRFDITLCAQRRQQTQETD-------NR 166
                 .:..|.:||||.:|:|||             |..||||...|.|.....|:       .:
pombe   133 SYKYAAEPFSSLRKLLTNGSFYF-------------SLDFDITTRLQLRTSQTMTEPQYDSMHTQ 184

  Fly   167 FFWNRMMHIHLMRF----------GIDCQSWLLQAMCGSVEVRTVYIGAKQARAAIISRLSCERA 221
            |.||..|...|::|          .:|...:...|:.|........:|.:..|.::|||||..||
pombe   185 FMWNEFMLRQLIKFRSHLNGDEKSALDGCRFFTCAIRGFASTEQFKLGIQTIRLSLISRLSSLRA 249

  Fly   222 GTRFNVRGTNDEGYVANFVETEQVIYVDGDVTSYVQTRGSVPLFWEQPGVQVGSHKVKLSRGFET 286
            ||||..||.:|:|.||||||||.::.......||.|.|||:|:||||.|||:...|:.::|..|.
pombe   250 GTRFLSRGVDDDGNVANFVETETILDSSKYCVSYCQVRGSIPIFWEQEGVQMFGQKIDITRSLEA 314

  Fly   287 SAAAFDRHMSMMRQRYGYQTVVNLLGSSLVGSKEGEAMLSNEFQRHHGMSAHKDVPHVV-FDYHQ 350
            :.|||::|.:.:.:.||...::||||:   ||  ||..||...::|..:|..||:.|:. ||||.
pombe   315 TRAAFEKHFTSLIEEYGPVHIINLLGT---GS--GERSLSERLRQHIQLSPEKDLIHLTEFDYHS 374

  Fly   351 ECRGGNFSALAKLKERIVACGANYGVFHASN-GQVLREQFGVVRTNCLDCLDRTNCVQTYLGLDT 414
            :.|  :|....|::..|.:....:|.:..:| ||.:..|.||.||||||||||||.:|..:.   
pombe   375 QIR--SFEDANKIRPMIYSDAETFGFYFENNEGQSIVVQDGVFRTNCLDCLDRTNVIQNLVS--- 434

  Fly   415 LGIQLEALKMGGKQQNISRFEEIFRQMWINNGNEVSKIYAGTGAIQG----------GSKLMDGA 469
             .:.||.:.:..:|.....|.::...:|.|||:.:::||.||||::.          ...|.|.:
pombe   435 -RVFLEQVMIYTRQNAGYDFWQVHSTIWANNGDALARIYTGTGALKSSFTRKGKLSIAGALNDLS 498

  Fly   470 RSAARTIQNNLLDNSKQEAIDVLLVGSTLSSELADRARILLPSNMLHAPTTVLRELCKRYTEYVR 534
            :|..|...||..|..:||.||:||      ..|.|:..::| .:.:|  ..|..||.||..|:..
pombe   499 KSVGRMYINNFQDKGRQETIDLLL------GRLIDQHPVIL-YDPIH--EYVNHELRKRENEFSE 554

  Fly   535 PRMARVAVGTYNVNGGKHFRSIVFKDSLADWLLDCHALARSKALVDVNNPSENVDHPVDIYAIGF 599
            .:..::.|.:||:||    .|...|  |.:||.            ..|.|.      .|||.:||
pombe   555 HKNVKIFVASYNLNG----CSATTK--LENWLF------------PENTPL------ADIYVVGF 595

  Fly   600 EEIVDLNASNIMAASTDNAKLWAEELQKTI----SRDNDYVLLTYQQLVGVCLYIYIRPEHAPHI 660
            :|||.|....:::|.....:.|...:::.:    :....||.|...||||..|.|:.:....|.|
pombe   596 QEIVQLTPQQVISADPAKRREWESCVKRLLNGKCTSGPGYVQLRSGQLVGTALMIFCKESCLPSI 660

  Fly   661 RDVAIDCVKTGLGGATGNKGACAIRFVLHGTSMCFVCAHFAAGQSQVAERNADYAEITRKLAFPM 725
            ::|.....||||||.:|||||.||||....|.:||:.:|.|||.:...||:.||..|...|.|..
pombe   661 KNVEGTVKKTGLGGVSGNKGAVAIRFDYEDTGLCFITSHLAAGYTNYDERDHDYRTIASGLRFRR 725

  Fly   726 GRTLKSHDWVFWCGDFNYRIDMEKDELKECVRNGDLSTVLEFDQLRKEQEAGNVFGEFLEGEITF 790
            ||::.:||:|.|.|||||||.:..:|:..|:..|.||.:.|:|||.|:...|.||..|.|..|||
pombe   726 GRSIFNHDYVVWFGDFNYRISLTYEEVVPCIAQGKLSYLFEYDQLNKQMLTGKVFPFFSELPITF 790

  Fly   791 DPTYKYDLFSDDYDTSEKQRAPAWTDRVLWRRRKALAEGDFAASAWNPGKLI--HYGRSELKQSD 853
            .||||:|:.:|.||||:|.|.||||||:|:|                 |:|:  .|....|..||
pombe   791 PPTYKFDIGTDIYDTSDKHRVPAWTDRILYR-----------------GELVPHSYQSVPLYYSD 838

  Fly   854 HRPVIAIIDAEIMEIDQQRRRAVFE-------QVIRDLGPPDSTIVVHVLESSATGDEDGPTIYD 911
            |||:.|..:|.|:::|:::::.:||       |.:||......|::  .:..|..|..:      
pombe   839 HRPIYATYEANIVKVDREKKKILFEELYNQRKQEVRDASQTSYTLI--DIAGSVAGKPN------ 895

  Fly   912 ENVMSALITELSKMGEVTLVRY--VEDTMWVTFRDGESALNASSKKSIQVCGLDLILELKSKDWQ 974
                  ||..|...| |..::.  .|.:.| .|.||                    |..||    
pombe   896 ------LIPHLPANG-VDKIKQPSSERSKW-WFDDG--------------------LPAKS---- 928

  Fly   975 HLVDSEIELCTTNTIPLCANPVEHAQLLQAITPELPQRPKQPPTRP------------------- 1020
                            :.|.|....:|    .|..|..|.:|...|                   
pombe   929 ----------------IAAPPGPEYRL----NPSRPINPFEPTAEPDWISNTKQSFDKKSSLIDS 973

  Fly  1021 -PARPPMPMSPKNS--PRHLPHVGVISIVP-KPAKPPMPPQPQSQPL-----------IPSP-LQ 1069
             ||..|.|.|...|  ........:|.|.| ||.||.....|:.:||           :|:| |.
pombe   974 IPALSPAPSSLARSSVSSQRSSTSIIPIKPNKPTKPDHLVAPRVKPLLPPRSGSSSSGVPAPNLT 1038

  Fly  1070 PQVAPPRPPAMDTTPSSKSQSPTELVSASSSTSS 1103
            |...||.||   ...||.||...:|:::|...||
pombe  1039 PVNVPPTPP---PRKSSASQRSGDLLASSPEESS 1069

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SynjNP_001246454.1 Syja_N 61..353 CDD:280532 110/339 (32%)
INPP5c_Synj 538..863 CDD:197323 125/331 (38%)
DUF1866 862..1008 CDD:286093 28/155 (18%)
syj1NP_596431.1 COG5329 1..582 CDD:227637 191/630 (30%)
Syja_N 60..374 CDD:280532 110/336 (33%)
COG5411 529..981 CDD:227698 168/556 (30%)
INPP5c_ScInp51p-like 558..848 CDD:197324 125/331 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 447 1.000 Inparanoid score I298
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001373
OrthoInspector 1 1.000 T631537
orthoMCL 1 0.900 OOG5_128608
Panther 1 1.100 LDO PTHR11200
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1445
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.