DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr58b and Gr66a

Sequence 1:NP_523808.2 Gene:Gr58b FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_523971.3 Gene:Gr66a FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster

Alignment Length:499 Identity:92/500 (18%)
Similarity:169/500 (34%) Gaps:160/500 (32%)


  Fly     9 VMNVVYYHSVVFALMSTTLRIRSCRKCLRLEKVSRTYTIYSFFVGIFL-FLNLYFMV-------- 64
            ::.||.|:.::::.......:::.:..|            :|.:|:|| ::.|..||        
  Fly    56 ILYVVLYNILIYSFGEEDRSLKASQSTL------------TFVIGLFLTYIGLIMMVSDQLTALR 108

  Fly    65 ----------------PRIMEDGYMKYNIVLQWNFFVMLFLRAI----AVVSCY----------G 99
                            .|:.::|.:..|..:.....:||.:..|    .:||.|          .
  Fly   109 NQGRIGELYERIRLVDERLYKEGCVMDNSTIGRRIRIMLIMTVIFELSILVSTYVKLVDYSQWMS 173

  Fly   100 TLWL------------KRHKIIQLYKYSLIYWKRFGHITRAIVDKKELLDLQESLARIMIRKIIL 152
            .||:            |....:.||...    :||..|...:   :||:|..|.      .|:.|
  Fly   174 LLWIVSAIPTFINTLDKIWFAVSLYALK----ERFEAINATL---EELVDTHEK------HKLWL 225

  Fly   153 LYSAFLCSTVLQYQLLSVINPQIFLAFCARLTHFLHFLCVKMGFFGVLVL---------LNHQFL 208
            ..:             ..:.|.:..:...:....|.:|..::|...:..:         .|....
  Fly   226 RGN-------------QEVPPPLDSSQPPQYDSNLEYLYKELGGMDIGSIGKSSVSGSGKNKVAP 277

  Fly   209 VIH--------------------LAINALH----GRKARKKWKALRSVAAMHLKTLRLARRIFDM 249
            |.|                    ||.|.:|    |..|:.:.| |.::..:|.:...:.:.:.::
  Fly   278 VAHSMNSFGEAIDAASRKPPPPPLATNMVHESELGNAAKVEEK-LNNLCQVHDEICEIGKALNEL 341

  Fly   250 --FDIANATVFINMFMTA-INILYHAVQYSNSSIKSNGWGILFGNG------LIVFNFWGTMALM 305
              :.|.:...:..:..|| :..||.|.||  .||.|     ||.:.      :||.::.....:.
  Fly   342 WSYPILSLMAYGFLIFTAQLYFLYCATQY--QSIPS-----LFRSAKNPFITVIVLSYTSGKCVY 399

  Fly   306 EMLDSVVTS--CNNTGQQLRQLSDLPKVGPKMQREL-----DVFTMQLRQNRLVYKICGIVELDK 363
            .:..|..||  ...||..|.      |.|......|     :..:::|..:.:.:..||...||.
  Fly   400 LIYLSWKTSQASKRTGISLH------KCGVVADDNLLYEIVNHLSLKLLNHSVDFSACGFFTLDM 458

  Fly   364 PACLSYIGSILSNVIILMQFDLRRQR--------QPINDRQYLI 399
            .......|.|.|.:|||:||:|..|:        ..:||...|:
  Fly   459 ETLYGVSGGITSYLIILIQFNLAAQQAKEAIQTFNSLNDTAGLV 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 87/473 (18%)
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 86/474 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.