DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr58b and lite-1

Sequence 1:NP_523808.2 Gene:Gr58b FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_509043.3 Gene:lite-1 WormBaseID:WBGene00001803 Length:439 Species:Caenorhabditis elegans

Alignment Length:446 Identity:93/447 (21%)
Similarity:162/447 (36%) Gaps:106/447 (24%)


  Fly     8 RVMNVVYYHSVVFALMSTTLRIRSCRKCLRLEKVSRTYTIYSFFV-GIFLFLNL----------- 60
            |.:..:||..::..| :.::|..:          |..:.|||:.| .:.||..|           
 Worm    46 RTLYPIYYLLLILGL-NQSIRPNN----------SLLFRIYSWLVFCLLLFTTLRKFNQVGVRPN 99

  Fly    61 --------YFMVPRIMEDGYMKYNIVLQWNFFVMLFLRAIAVVSCYGTLWLKRHKIIQ-LYKYSL 116
                    :|..||.|         :...|..:|| ...:|.:..| ||..||.|.:: |.::||
 Worm   100 GTRENLQEFFANPRSM---------ITLCNALIML-SGLLASLQLY-TLGAKRLKPLKILCQFSL 153

  Fly   117 IYWKRFGHITRAIVDKKELLDLQESLARIMIRKIILLYSAFLCSTVLQ--------YQLLSVINP 173
                             .:...|....:.||...:.::|..|..|:..        |.|..|..|
 Worm   154 -----------------NVRTKQAERRQFMINTFLAVFSGLLALTMAATYAMSKWGYILYIVGTP 201

  Fly   174 QI--FLAFCARLTHFLHFLCVKMGFFGVLVLLNHQFL-VIHLAINALHGR--KARKKWKALRSVA 233
            .:  ...||..|..:..|  |.......|.:|.:|.. ||..:|..|...  .|.:....|...:
 Worm   202 NLDTETIFCVLLDSYALF--VSRAAISALAILFYQHCSVIRRSIKHLINEMVPAEQDECPLPESS 264

  Fly   234 AMHLKTLRLA-RRIFDMFDIANATV-----FINMFMTAINI-LYHAVQYSNSSIKSNGWG----- 286
            ...:...::: :|||:    ..|.:     |:..:...:.| ::..:.:...|.:|..|.     
 Worm   265 LQKIHDCQISYQRIFN----GKAVIEEYYSFVLFYSYGVCIPIFCFLMFVGMSAQSICWSEVVSI 325

  Fly   287 -ILFGNGLIVFNFWGTMALM--EMLDSVVTSC----NNTGQQLRQLSDLPKVGPKMQRELDVFTM 344
             |...|.::|...:...|.|  |..|.:|.|.    :.|..:.|.|:.|        .::..||.
 Worm   326 VIWIVNAILVLLLFSLPAFMINEDGDRLVASSFRMYHETFHEERDLTVL--------SQMTFFTF 382

  Fly   345 QLRQNRLVYKICGIVELDKPACLSYIGSILSNVIILMQFDLRRQRQPINDRQYLIH 400
            |:...:|....|....:|:...||...:||:..:||.:||::..:...|...:.||
 Worm   383 QIHSTKLTLSACNYFYMDRSILLSLFSAILTYFLILWEFDIKNNQSLQNIANHTIH 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 89/426 (21%)
lite-1NP_509043.3 7tm_7 75..425 CDD:285581 83/392 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.