DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr58b and Gr22d

Sequence 1:NP_523808.2 Gene:Gr58b FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001259882.1 Gene:Gr22d FlyBaseID:FBgn0045498 Length:387 Species:Drosophila melanogaster

Alignment Length:444 Identity:89/445 (20%)
Similarity:169/445 (38%) Gaps:121/445 (27%)


  Fly     1 MLHPKLGRVMNVVY--YHSVVFALMSTTLRIRSCRKCLRLEKVSRTYTIYSFFVGIFLFLNLYFM 63
            |..|:.|.....||  ..|::::  |..|.|...:...:..::.|:..:..|.|.|...| |..|
  Fly     1 MFRPRCGLRQKFVYVILKSILYS--SWLLGIFPFKYEPKKRRLRRSMWLILFGVVISSSL-LILM 62

  Fly    64 VPRIMEDGYMKYNIVL---QWN---FFVMLFLRAIAVVS-C---YGTLWLKRHKIIQLYKYSLIY 118
            |.:..||  .::.|:|   |.|   :.:...:..:.||| |   ..|||..:|            
  Fly    63 VKQSAED--REHGIMLDVFQRNALLYQISSLMGVVGVVSICTVHLRTLWRSKH------------ 113

  Fly   119 WKRFGHITRAIVDKKELLDLQESLARIMIRKIILLYSAFLCST----------VLQYQLLSVINP 173
                               |:|     :...::||.:.:.||.          |:|..::.|:. 
  Fly   114 -------------------LEE-----IYNGLMLLEAKYFCSNAVECPAFDGYVIQKGVVIVVG- 153

  Fly   174 QIFLAFCARLTHF---------LHFLCVKMGFFGVLV-----------------LLNHQFLVIHL 212
                .....:.||         |:.|.|.|...|.|:                 |:|.:.|.:..
  Fly   154 ----LLAPWMVHFGMPDSKLPVLNVLVVSMVKLGTLLLALHYHLGVVIIYRFVWLINRELLSLVC 214

  Fly   213 AINALH-GRKARKKWKALRSVAAMHLKTLRLARRIFDMFDIANATVFINMFMTAINIL--YHAVQ 274
            ::...| |..:|     :|.:..::.|.:.|..::.|.:|.  .||.:.....|.||:  ::.:.
  Fly   215 SLRGNHKGSSSR-----VRFLLKLYNKLVNLYSKLADCYDC--QTVLMMAIFLAANIIVCFYMIV 272

  Fly   275 YSNSSIKSNGWGILFGNGLIVFN----FWGTMALMEMLDSVVTSCNNTGQQ----LRQLSDLPKV 331
            |..|..|.:.:.:|....|.:.|    ||.:|.:.::|       ..||:|    |:..:|:..:
  Fly   273 YRISLSKMSFFVMLIMFPLAIANNFMDFWLSMKVCDLL-------QKTGRQTSMILKLFNDIENM 330

  Fly   332 GPKMQRELDVFTMQLRQNRLVYKICGIVELDKPACLS-YIGSILSNVIILMQFD 384
            ...::..:..|.:.....|..:..||:..:::..... ::.|:| .::.|:|||
  Fly   331 DKDLEISISDFALYCSHRRFKFLHCGLFHVNREMGFKMFVASVL-YLLYLVQFD 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 86/434 (20%)
Gr22dNP_001259882.1 7tm_7 17..386 CDD:285581 84/429 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.