DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr58b and Gr22c

Sequence 1:NP_523808.2 Gene:Gr58b FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_722732.2 Gene:Gr22c FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster

Alignment Length:440 Identity:86/441 (20%)
Similarity:166/441 (38%) Gaps:135/441 (31%)


  Fly    19 VFALMSTTLRIRSCRKCLRLEKVSRTYTIY-SFFVGIFLFLNLYFMVPRI-MEDGYMK------- 74
            :||..| .|:.|.|...|:.       |:| |:|:|:|.:        |. ..:|.:|       
  Fly     1 MFASRS-DLQSRLCWIILKA-------TLYSSWFLGVFPY--------RFDSRNGQLKRSRFLLF 49

  Fly    75 YNIVLQWNFFVMLFLRAIAVVSCYGTLWL------KRHKIIQLYKYS----------LIYWKRFG 123
            |.::|  |||::|      .:.|.|...|      .|:.:::...|:          :|::..|.
  Fly    50 YGLIL--NFFLLL------KMVCSGGQKLGIPEAFARNSVLENTHYTTGMLAVFSCVVIHFLNFW 106

  Fly   124 HITRA--------IVDKKELLDLQES----LARIMIRKIILLYSAFLCSTVLQYQL--------L 168
            ..||.        :::.::...|.|:    ....:|:|.:.:....|....:.|.|        :
  Fly   107 GSTRVQDLANELLVLEYQQFASLNETKCPKFNSFVIQKWLSVIGLLLSYLSIAYGLPGNNFSVEM 171

  Fly   169 SVINPQIFLAFCARLTHFLHFLCVKMGFFGVLV------LLNHQFL--VIHLAINALHGRKARKK 225
            .:||..:..:|...:.|:         :.|||:      |:|.|.|  |.:|.::.         
  Fly   172 VLINSLVQFSFNCNIMHY---------YIGVLLIYRYLWLINGQLLEMVTNLKLDC--------- 218

  Fly   226 WKALRSVAAMHL-KTLRLARRIFDMFDIANATVFINMFMTAINILYHAVQYSNSSIKSN-----G 284
                 ||.:..: |.|.|.||:.::.....||           ..||......:.:.||     .
  Fly   219 -----SVDSSRIRKYLSLYRRLLELKGYMVAT-----------YEYHMTLVLTTGLASNFLAIYS 267

  Fly   285 WGIL-------------FGNGLI--VFNFWGTMALMEMLDSVVTSCNNTGQQLRQLSDLPKVGPK 334
            |.:|             |...|:  |:|.|.::|..::.::...|   |...|:..:||.....:
  Fly   268 WIVLDISMNINFIYLLIFPLFLLVNVWNLWLSIAASDLAENAGKS---TQTVLKLFADLEVKDIE 329

  Fly   335 MQRELDVFTMQLRQNRLVYKICGIVELDKPACLSYIGSILSNVIILMQFD 384
            ::|.::.|.:.....:..:.:||:..::.......|.:....:|.::|||
  Fly   330 LERSVNEFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQFD 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 86/441 (20%)
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 80/424 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.