| Sequence 1: | NP_523808.2 | Gene: | Gr58b / 37502 | FlyBaseID: | FBgn0041238 | Length: | 408 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_724040.1 | Gene: | Gr36c / 117486 | FlyBaseID: | FBgn0045485 | Length: | 390 | Species: | Drosophila melanogaster | 
| Alignment Length: | 428 | Identity: | 70/428 - (16%) | 
|---|---|---|---|
| Similarity: | 166/428 - (38%) | Gaps: | 98/428 - (22%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     9 VMNVVYYHSVVFALMS-----TTLRIRSCRKCLRLEKVSRTYTIYSFFV----GIFLFLNLYFMV 64 
  Fly    65 PRIMEDGYMKYNIVLQWNFFVMLFLRAIAVVSCYGTL---WLKR-------HKIIQLY--KYSLI 117 
  Fly   118 YWKRFGHITRAIVDKKELLDLQESLARIMIRKII-LLYSAFLCSTVLQYQLLSVINPQIFLAFCA 181 
  Fly   182 RLTHFLHFLCVKMGFFGVLVLLNHQFLVI-----HLAINALHGRKARKKWKAL----RSVAAMHL 237 
  Fly   238 KTLRLARRIFDMFDIANATVFINMFMTAINILYHAVQ-----YSNSS------IKSNGWGILFG- 290 
  Fly   291 NGLIVF--------NFWGTMALMEMLDSVVTSCNNTGQQLRQLSDLPKVGPKMQRELDVFTMQLR 347 
  Fly   348 QNRLVYKICGIVELDKPACLSYIGSILSNVIILMQFDL 385 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Gr58b | NP_523808.2 | 7tm_7 | 12..385 | CDD:285581 | 69/423 (16%) | 
| Gr36c | NP_724040.1 | 7tm_7 | 8..389 | CDD:285581 | 70/427 (16%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR21143 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||