DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and Glrx

DIOPT Version :10

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_444338.2 Gene:Glrx / 93692 MGIID:2135625 Length:107 Species:Mus musculus


Alignment Length:92 Identity:32/92 - (34%)
Similarity:51/92 - (55%) Gaps:3/92 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QFVRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIE---LDQRDDGNEIQAVLGEMTGSR 84
            :||...|...|||:|.|..||||...:|...::..|..::|   :...::.:.||..|.::||:|
Mouse     4 EFVNCKIQSGKVVVFIKPTCPYCRKTQEILSQLPFKQGLLEFVDITATNNTSAIQDYLQQLTGAR 68

  Fly    85 TVPRCFIDGKFVGGGTDVKRLYEQGIL 111
            ||||.||....:||.:|:..:.:.|.|
Mouse    69 TVPRVFIGKDCIGGCSDLISMQQTGEL 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 29/82 (35%)
GlrxNP_444338.2 GRX_euk 15..99 CDD:274016 28/81 (35%)

Return to query results.
Submit another query.