DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and AT1G03020

DIOPT Version :10

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_171801.1 Gene:AT1G03020 / 839505 AraportID:AT1G03020 Length:102 Species:Arabidopsis thaliana


Alignment Length:81 Identity:27/81 - (33%)
Similarity:38/81 - (46%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIELDQRDDGNEIQAVLGEMTGSRTVPRC 89
            :.:.:....||||||:.|......|.........:||.|||:..:|.||:..|.|:....|||..
plant     4 ISNLLEDKPVVIFSKTSCCMSHSIKSLISGYGANSTVYELDEMSNGPEIERALVELGCKPTVPAV 68

  Fly    90 FIDGKFVGGGTDVKRL 105
            ||..:.|||...:..|
plant    69 FIGQELVGGANQLMSL 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 27/73 (37%)
AT1G03020NP_171801.1 GlrX-like_plant 4..101 CDD:274023 27/81 (33%)

Return to query results.
Submit another query.