DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx1t and GLRX

DIOPT Version :10

Sequence 1:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_002055.1 Gene:GLRX / 2745 HGNCID:4330 Length:106 Species:Homo sapiens


Alignment Length:92 Identity:36/92 - (39%)
Similarity:53/92 - (57%) Gaps:3/92 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QFVRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATVIE---LDQRDDGNEIQAVLGEMTGSR 84
            :||...|...|||:|.|..||||..|:|...::.:|..::|   :...:..||||..|.::||:|
Human     4 EFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGAR 68

  Fly    85 TVPRCFIDGKFVGGGTDVKRLYEQGIL 111
            ||||.||....:||.:|:..|.:.|.|
Human    69 TVPRVFIGKDCIGGCSDLVSLQQSGEL 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 33/82 (40%)
GLRXNP_002055.1 GRX_euk 15..99 CDD:274016 32/81 (40%)

Return to query results.
Submit another query.