DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and TOX4

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_055643.1 Gene:TOX4 / 9878 HGNCID:20161 Length:621 Species:Homo sapiens


Alignment Length:108 Identity:29/108 - (26%)
Similarity:48/108 - (44%) Gaps:15/108 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNK 66
            :.|::|:|||.|:..:|:..||..||.:...:::|....:|..|  :.|..:::|....|:||.|
Human   221 NEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLK 285

  Fly    67 AVKEY-------------EANGGTDSGAPKKRKKAAAKPAKKA 96
            |:..|             |.:....|..|.....|...||..|
Human   286 ALAAYKDNQECQATVETVELDPAPPSQTPSPPPMATVDPASPA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 21/66 (32%)
TOX4NP_055643.1 NHP6B 140..>306 CDD:227935 23/84 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..227 1/5 (20%)
Nuclear localization signal. /evidence=ECO:0000255 213..218
HMG-box 223..288 CDD:238037 21/64 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..333 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..529
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.