powered by:
Protein Alignment HmgZ and NHP6B
DIOPT Version :9
| Sequence 1: | NP_001286694.1 |
Gene: | HmgZ / 37480 |
FlyBaseID: | FBgn0010228 |
Length: | 111 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_009647.2 |
Gene: | NHP6B / 852386 |
SGDID: | S000002157 |
Length: | 99 |
Species: | Saccharomyces cerevisiae |
| Alignment Length: | 70 |
Identity: | 25/70 - (35%) |
| Similarity: | 38/70 - (54%) |
Gaps: | 2/70 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNKAV 68
|||.|||||.:.||.|:.::.:||......:.:..||.|:.| ::|..:|.||...|:.|....
Yeast 27 PKRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGERWKALTAEEKQPYESKAQADKKRYESEK 91
Fly 69 KEYEA 73
:.|.|
Yeast 92 ELYNA 96
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
1 |
1.050 |
56 |
1.000 |
Inparanoid score |
I1797 |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000133 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.860 |
|
Return to query results.
Submit another query.