DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and AT1G55650

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_175961.1 Gene:AT1G55650 / 842014 AraportID:AT1G55650 Length:337 Species:Arabidopsis thaliana


Alignment Length:125 Identity:33/125 - (26%)
Similarity:54/125 - (43%) Gaps:26/125 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNKAV 68
            |||..:.|..::.|...:||.:|.|.||:. .|..|.:|..|  .|:..:.:|:.:..:.|...:
plant   215 PKRQRTGYNFFVAEQSVRIKAENAGQKVSS-PKNFGNMWTNLSESDRKVYYEKSREDGKRYKMEI 278

  Fly    69 KEY---------EANGGTDSGAPKKRKKAAAKPAKKAKKKE----------SSEEEEEDE 109
            .:|         |....||:|.    ..:||:.|.:|.::.          ||..|.|||
plant   279 LQYRSLMESRVAEIVAATDAGT----SASAAETADEASQENLAKTDACTSASSAAETEDE 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 18/66 (27%)
AT1G55650NP_175961.1 BRIGHT 35..126 CDD:128777
HMGB-UBF_HMG-box 215..278 CDD:238686 18/63 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.