DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and HMGB4

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001031364.2 Gene:HMGB4 / 816263 AraportID:AT2G17560 Length:138 Species:Arabidopsis thaliana


Alignment Length:111 Identity:35/111 - (31%)
Similarity:58/111 - (52%) Gaps:11/111 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DRPKRPLSAYMLWLNETREQIKKDNPGSK-VTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYN 65
            ::||||.||:.::|.:.|::....||.:| |..:.|..|..|:.:  :||..:..||...|.||.
plant    33 NQPKRPPSAFFVFLEDFRKEFNLANPNNKSVATVGKAAGARWKAMTDEDKAPYVAKAESRKTEYI 97

  Fly    66 KAVKEYEAN--GGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEEDE 109
            |.|::|...  .||:      |::..:..:|....:..||||.||:
plant    98 KNVQQYNLKLASGTN------REEDDSDKSKSEVDEAVSEEEAEDD 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 24/67 (36%)
HMGB4NP_001031364.2 HMG_box 35..103 CDD:278906 24/67 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3986
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2470
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm3241
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.