DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and sox1

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001074465.1 Gene:sox1 / 779569 XenbaseID:XB-GENE-1018269 Length:401 Species:Xenopus tropicalis


Alignment Length:93 Identity:24/93 - (25%)
Similarity:49/93 - (52%) Gaps:9/93 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLK--DKTEWEQKAIKMKEEYNK 66
            ||.|||::|:|:|....|.::.::||....::|:||.|..|:.:.  :|..:..:|.:::..:.|
 Frog    35 DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRALHMK 99

  Fly    67 AVKEYEANGGTDSGAPKKRKKAAAKPAK 94
            ...:|:..       |:::.|...|..|
 Frog   100 EHPDYKYR-------PRRKTKTLLKKDK 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 16/65 (25%)
sox1NP_001074465.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 2/2 (100%)
HMG-box_SoxB 35..114 CDD:438790 21/85 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..249
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..343
9aaTAD. /evidence=ECO:0000250|UniProtKB:P41225 345..353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.