powered by:
Protein Alignment HmgZ and UBTF
DIOPT Version :9
| Sequence 1: | NP_001286694.1 |
Gene: | HmgZ / 37480 |
FlyBaseID: | FBgn0010228 |
Length: | 111 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_016880484.1 |
Gene: | UBTF / 7343 |
HGNCID: | 12511 |
Length: | 781 |
Species: | Homo sapiens |
| Alignment Length: | 104 |
Identity: | 25/104 - (24%) |
| Similarity: | 48/104 - (46%) |
Gaps: | 18/104 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 DRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDKTEWEQKAIKMKEEYNKAV 68
::||||:||..::..|.|.|::::.|....:::.:....:|..|.:|.:.:.|| :|...||.
Human 405 EKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKA---REAALKAQ 466
Fly 69 KEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEE 107
.| :|...:..::.|..||.:..||
Human 467 SE---------------RKPGGEREERGKLPESPKRAEE 490
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| HmgZ | NP_001286694.1 |
HMG_box |
6..71 |
CDD:395407 |
18/64 (28%) |
| UBTF | XP_016880484.1 |
None |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.