DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and TCF7

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_006714741.1 Gene:TCF7 / 6932 HGNCID:11639 Length:460 Species:Homo sapiens


Alignment Length:96 Identity:23/96 - (23%)
Similarity:43/96 - (44%) Gaps:18/96 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIK---------- 59
            |:||:|:||::.|.|.::..:....:...|.:..|..|..|  :::.::.:.|.|          
Human   301 KKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYP 365

  Fly    60 ---MKEEYNK---AVKEYEANGGTDSGAPKK 84
               .::.|.|   ..:|......||.|:|||
Human   366 GWSARDNYGKKKRRSREKHQESTTDPGSPKK 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 16/81 (20%)
TCF7XP_006714741.1 CTNNB1_binding 20..212 CDD:285538
SOX-TCF_HMG-box 300..370 CDD:238684 14/68 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.