DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and Hmg20a

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_080088.1 Gene:Hmg20a / 66867 MGIID:1914117 Length:346 Species:Mus musculus


Alignment Length:110 Identity:30/110 - (27%)
Similarity:54/110 - (49%) Gaps:10/110 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNKAV 68
            ||.||:.|:.::||.|||::...|.....:|.:..|..|..|  ::|..:..:|.:.||.|.|.:
Mouse   102 PKSPLTGYVRFMNERREQLRAKRPEVPFPEITRMLGNEWSKLPPEEKQRYLDEADRDKERYMKEL 166

  Fly    69 KEYE--------ANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEE 105
            ::|:        :....|....|..::.||:.|....:||:..:|
Mouse   167 EQYQKTEAYKVFSRKTQDRQKGKSHRQDAARQATHDHEKETEVKE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 21/66 (32%)
Hmg20aNP_080088.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112 5/9 (56%)
DUF5401 <76..312 CDD:375164 30/110 (27%)
HMGB-UBF_HMG-box 102..167 CDD:238686 21/64 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..210 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.