DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and SOX10

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_008872.1 Gene:SOX10 / 6663 HGNCID:11190 Length:466 Species:Homo sapiens


Alignment Length:99 Identity:28/99 - (28%)
Similarity:52/99 - (52%) Gaps:13/99 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGDRP--KRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKE 62
            |..:|  |||::|:|:|....|.::....|.....:::|..|:|||.|  .||..:.::|.:::.
Human    98 SKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRM 162

  Fly    63 EYNKAVKEYEANGGTDSGAPKKRK--KAAAKPAK 94
            ::.|...:|:..       |::||  |||...|:
Human   163 QHKKDHPDYKYQ-------PRRRKNGKAAQGEAE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 19/68 (28%)
SOX10NP_008872.1 Sox_N 12..93 CDD:315171
Dimerization (DIM). /evidence=ECO:0000303|PubMed:31194875 62..102 1/3 (33%)
SOX-TCF_HMG-box 103..173 CDD:238684 19/69 (28%)
Nuclear export signal 134..145 5/10 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..199 9/37 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..274
Transactivation domain (TAM). /evidence=ECO:0000303|PubMed:31194875 228..310
Transactivation domain (TAC). /evidence=ECO:0000303|PubMed:31194875 353..466
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..375
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..466
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.