powered by:
Protein Alignment HmgZ and hmgxb4a
DIOPT Version :9
| Sequence 1: | NP_001286694.1 |
Gene: | HmgZ / 37480 |
FlyBaseID: | FBgn0010228 |
Length: | 111 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_005163967.1 |
Gene: | hmgxb4a / 559742 |
ZFINID: | ZDB-GENE-070912-675 |
Length: | 632 |
Species: | Danio rerio |
| Alignment Length: | 67 |
Identity: | 24/67 - (35%) |
| Similarity: | 40/67 - (59%) |
Gaps: | 3/67 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 DRPKRP-LSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYN 65
|:||:. ::||.::..|.|..|..:.||....:::|:..|:|:.| |||..|.|||..::.:.|
Zfish 434 DKPKKKNMTAYQVFCKEYRVNINAEQPGLVFGELSKKLAEVWKQLPEKDKLVWRQKAQYLQHKQN 498
Fly 66 KA 67
||
Zfish 499 KA 500
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| HmgZ | NP_001286694.1 |
HMG_box |
6..71 |
CDD:395407 |
23/65 (35%) |
| hmgxb4a | XP_005163967.1 |
DUF4171 |
121..262 |
CDD:290491 |
|
| HMG-box |
441..500 |
CDD:238037 |
19/58 (33%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.