DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and sox7

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001016326.1 Gene:sox7 / 549080 XenbaseID:XB-GENE-488067 Length:362 Species:Xenopus tropicalis


Alignment Length:88 Identity:19/88 - (21%)
Similarity:47/88 - (53%) Gaps:9/88 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGDRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLK--DKTEWEQKAIKMKEEY 64
            |..|.:||::|:|:|..:.|:::...||.....:::|..|:.|:.|.  .|..:.::|.:::.::
 Frog    38 SETRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALSPAQKRPYVEEAERLRVQH 102

  Fly    65 NKAVKEYEANGGTDSGAPKKRKK 87
            .:....|:..       |:::|:
 Frog   103 MQDYPNYKYR-------PRRKKQ 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 14/66 (21%)
sox7NP_001016326.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..41 1/2 (50%)
SOX-TCF_HMG-box 41..112 CDD:238684 16/70 (23%)
Sox17_18_mid 171..218 CDD:371880
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.