DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and sox11

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001008053.1 Gene:sox11 / 493415 XenbaseID:XB-GENE-483418 Length:383 Species:Xenopus tropicalis


Alignment Length:170 Identity:43/170 - (25%)
Similarity:60/170 - (35%) Gaps:69/170 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDK------TEWEQKAIKMKEEY- 64
            |||::|:|:|....|.:|.:.:|.....:|:||.|:.|:.|.|.      .|.|:..:|...:| 
 Frog    49 KRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLNDSEKIPFIREAERLRLKHMADYP 113

  Fly    65 --------------------------NKAVKEYEAN----------------------------- 74
                                      .|:.|...|.                             
 Frog   114 DYKYRPRKKPKVDPSASKPASLAQSPEKSPKSRSAGKKCPKLKPGSHSGSSSSSGSAKSLTIKSE 178

  Fly    75 -GGTD--SGAPKKRKKAAAKPAKKAKKKESSEEEEEDESE 111
             ||.|  .|:|    |||:|.||.....|..|||||||.|
 Frog   179 YGGDDYVFGSP----KAASKAAKCVFMDEDDEEEEEDEEE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 22/96 (23%)
sox11NP_001008053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
SOX-TCF_HMG-box 47..118 CDD:238684 20/68 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..174 3/58 (5%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..231 10/18 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.