DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and sox11

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001008053.1 Gene:sox11 / 493415 XenbaseID:XB-GENE-483418 Length:383 Species:Xenopus tropicalis


Alignment Length:170 Identity:43/170 - (25%)
Similarity:60/170 - (35%) Gaps:69/170 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDK------TEWEQKAIKMKEEY- 64
            |||::|:|:|....|.:|.:.:|.....:|:||.|:.|:.|.|.      .|.|:..:|...:| 
 Frog    49 KRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLNDSEKIPFIREAERLRLKHMADYP 113

  Fly    65 --------------------------NKAVKEYEAN----------------------------- 74
                                      .|:.|...|.                             
 Frog   114 DYKYRPRKKPKVDPSASKPASLAQSPEKSPKSRSAGKKCPKLKPGSHSGSSSSSGSAKSLTIKSE 178

  Fly    75 -GGTD--SGAPKKRKKAAAKPAKKAKKKESSEEEEEDESE 111
             ||.|  .|:|    |||:|.||.....|..|||||||.|
 Frog   179 YGGDDYVFGSP----KAASKAAKCVFMDEDDEEEEEDEEE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 21/96 (22%)
sox11NP_001008053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
HMG-box_SoxC_SOX11 37..128 CDD:438846 20/78 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..174 3/58 (5%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..231 10/18 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.