DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and tcf7l1

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001005640.1 Gene:tcf7l1 / 448107 XenbaseID:XB-GENE-1031985 Length:553 Species:Xenopus tropicalis


Alignment Length:94 Identity:22/94 - (23%)
Similarity:47/94 - (50%) Gaps:4/94 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNKAVK 69
            |:||:|:||::.|.|.::..:....:...|.:..|..|..|  :::.::.:.|.|.::.:::...
 Frog   325 KKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYP 389

  Fly    70 EYEANGGTDSGAPKKRKKAAAKPAKKAKK 98
            .:.|.  .:.|..||||:....|..:..|
 Frog   390 TWSAR--DNYGKRKKRKRDKQSPEMEITK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 14/65 (22%)
tcf7l1NP_001005640.1 CTNNB1_binding 1..228 CDD:369826
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
Interaction with CTNNB1. /evidence=ECO:0000250 1..61
Interaction with AES and TLE4. /evidence=ECO:0000250 109..312
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..213
SOX-TCF_HMG-box 323..394 CDD:238684 14/68 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..474 8/27 (30%)
Interaction with CTBP. /evidence=ECO:0000250 408..553 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.