DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and Pbrm1

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_006252748.1 Gene:Pbrm1 / 306254 RGDID:1565549 Length:1726 Species:Rattus norvegicus


Alignment Length:77 Identity:22/77 - (28%)
Similarity:41/77 - (53%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLK--DKTEWEQKAIKMKE--EYNKAVKE 70
            :|.|:|:.:|.|..||..:|.....::::..|..||.|:  .|.|:|::|.|..|  |..:|.::
  Rat  1420 MSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAEYEERAAKAAEQQERERAAQQ 1484

  Fly    71 YEANGGTDSGAP 82
            .:.:....:|.|
  Rat  1485 QQPSASPRAGTP 1496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 20/64 (31%)
Pbrm1XP_006252748.1 Bromo_polybromo_I 65..177 CDD:99954
Bromo_polybromo_II 203..305 CDD:99948
Bromo_polybromo_III 404..505 CDD:99951
Bromo_polybromo_IV 556..659 CDD:99949
Bromo_polybromo_V 695..799 CDD:99946
Bromo_polybromo_VI 812..919 CDD:99956
BAH_polybromo 994..1111 CDD:240068
BAH_polybromo 1192..1310 CDD:240068
HMG-box 1417..1481 CDD:238037 19/60 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.