DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and Hmgb3

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_003751730.1 Gene:Hmgb3 / 305373 RGDID:1564407 Length:241 Species:Rattus norvegicus


Alignment Length:108 Identity:47/108 - (43%)
Similarity:63/108 - (58%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKD--KTEWEQKAIKMKEEYNKAV 68
            ||||.|.:.|:.:|.|.:||..|||..:.|:||:.||:|..|.|  |..:..||.|:||:|.|.|
  Rat   134 PKRPPSGFFLFCSEFRPKIKSANPGISIGDVAKKLGEMWNNLSDSEKQPYMTKAAKLKEKYEKDV 198

  Fly    69 KEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEEDESE 111
            .:|::.|..|         .|..|||.|:||...|||||:|.|
  Rat   199 ADYKSKGKFD---------GAKGPAKVARKKVEEEEEEEEEEE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 30/66 (45%)
Hmgb3XP_003751730.1 HMG_box_2 54..119 CDD:286146
HMG_box 134..201 CDD:278906 30/66 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.