powered by:
Protein Alignment HmgZ and Tox4
DIOPT Version :9
| Sequence 1: | NP_001286694.1 |
Gene: | HmgZ / 37480 |
FlyBaseID: | FBgn0010228 |
Length: | 111 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_775446.2 |
Gene: | Tox4 / 286990 |
RGDID: | 708449 |
Length: | 619 |
Species: | Rattus norvegicus |
| Alignment Length: | 73 |
Identity: | 23/73 - (31%) |
| Similarity: | 42/73 - (57%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 DRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNK 66
:.|::|:|||.|:..:|:..||..||.:...:::|....:|..| :.|..:::|....|:||.|
Rat 221 NEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLK 285
Fly 67 AVKEYEAN 74
|:..|:.|
Rat 286 ALAAYKDN 293
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.