DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HmgZ and TOX3

DIOPT Version :9

Sequence 1:	NP_001286694.1	Gene:	HmgZ / 37480	FlyBaseID:	FBgn0010228	Length:	111	Species:	Drosophila melanogaster
Sequence 2:	NP_001073899.2	Gene:	TOX3 / 27324	HGNCID:	11972	Length:	576	Species:	Homo sapiens

Alignment Length:	93	Identity:	28/93 - (30%)
Similarity:	49/93 - (52%)	Gaps:	11/93 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 DRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNK 66
            :.|::|:|||.|:..:|:..||..||.:...:::|....:|..|  :.|..:::|....|:||.|
Human   253 NEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLK 317

  Fly    67 AVKEYEANGGTDSGAPKKRKKAAAKPAK 94
            |:..|.|:         ...||||:.|:
Human   318 ALAAYRAS---------LVSKAAAESAE 336

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HmgZ	NP_001286694.1	HMG_box	6..71	CDD:395407	21/66 (32%)
TOX3	NP_001073899.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	189..258		1/4 (25%)
		HMG-box	255..320	CDD:238037	21/64 (33%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	422..443
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	519..563
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5648
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810