DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and Ssrp1

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001129553.1 Gene:Ssrp1 / 20833 MGIID:107912 Length:708 Species:Mus musculus


Alignment Length:131 Identity:56/131 - (42%)
Similarity:77/131 - (58%) Gaps:25/131 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNKAV 68
            ||||:||||||||.:||:||.|:||..:||::|:.||:|:|:  :.|.||::||...:.||.||:
Mouse   547 PKRPMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARREYEKAM 611

  Fly    69 KEYEANGGTDS--GAPKKRKKAAAKPAKKA-------------------KKKE--SSEEEEEDES 110
            ||||...|..|  ...||:||..||..||:                   |.||  ||:|....|:
Mouse   612 KEYEGGRGDSSKRDKSKKKKKVKAKMEKKSTPSRGSSSKSSSRQLSDSFKSKEFVSSDESSSGEN 676

  Fly   111 E 111
            :
Mouse   677 K 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 36/66 (55%)
Ssrp1NP_001129553.1 POB3 21..480 CDD:227494
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 458..708 56/131 (43%)
HMG_box 547..614 CDD:366139 36/66 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7588
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.